KEGG   Idiomarina loihiensis L2TR: IL1754Help
Entry
IL1754            CDS       T00218                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ilo01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ilo00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888552..1890006
Genome map
AA seq 484 aa AA seqDB search
MSDTIRLEKNVLKTIVERKVEQNKTQAELMPLSEIKSQLRPSDRSLYEALSGEQAGFILE
CKKASPSKGLIRADFDAPQLAKSYQPYAAAISVLTEPEFFQGRLDYLTAVRRQVTQPVLC
KDFFIDEEQVYRARYFGADAILLMLSVLDDAQYIALRDIAESLAMDVLTEVANEEEMKRA
AKLDANIIGINHRDLTDLSIEPNRSAQLAPLAPQNALLIAESGFAEHADIRRVAPFVNGF
LIGSALSAQPDVDLACRKLLYGQNKVCGLTRAEDAINARSQGAVFGGLIFVERSPRCVTL
KQAKQITTEANGLEYVGVFADQPLESLIDTAKYVGLSAIQLHGHEDIDYVVQLRQQLRQA
GLEAVKIWKALAIESPAQLPDLAVDAFVLDNRGGGSGKAFNWELLEPLSTEERQRCLLAG
GIGPESISSAIELGFAGVDINSQAEWKPGIKNSQKVAQTFTKIRHYGRFSEKHLSNKNTQ
QEAV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccattcgtttagaaaagaacgtgctgaaaacgatcgttgagcgcaaggtt
gagcagaacaaaactcaggccgagctcatgcccctgagtgaaataaagtctcagctcaga
cccagtgaccgtagcttatatgaagcattaagcggtgagcaggcaggttttattctggag
tgtaaaaaagcctctccttcaaaaggtttaattcgtgctgactttgacgcaccacagttg
gcaaaaagctaccagccttatgccgcagctatttccgtattaaccgagcctgagtttttt
caggggcgactggactatctgacagccgtgcgccggcaggttacccagccggttttatgc
aaagacttttttattgatgaagagcaagtttaccgcgcccgctactttggtgcggatgct
attttgcttatgttatcagtcctggatgatgcgcaatatatcgccctgcgcgatatagct
gagtcacttgcgatggatgtactcaccgaagttgccaacgaagaagaaatgaaacgtgcc
gcgaaactggacgcaaacatcattggcattaaccaccgcgatttaacagacttgagcatt
gagccgaaccgcagtgcgcagttagctccgctggctccccaaaatgccttactcattgca
gagtcaggttttgctgagcacgccgacattcgccgggttgccccttttgttaacggcttt
cttatcggcagcgcattgagcgcccagccggacgttgatttagcctgccgcaaactgctt
tatggacaaaataaagtttgcggtctgactcgcgctgaagatgccataaacgcacgttct
cagggtgcggtattcggcgggctaatatttgttgagcgttcacctcgttgtgtgacactg
aagcaggcaaagcaaataacaactgaagcaaacggacttgagtatgtgggtgtttttgct
gatcaaccgttagagagccttatcgacacggcaaaatacgtcgggctctctgctattcaa
ctgcacggccatgaagatatcgactatgttgttcaattacgtcagcaattgcgtcaggca
ggtctggaagcagtaaaaatatggaaagctttagctattgaaagcccggcacagttgccg
gatcttgcggttgatgcatttgttctggataaccgcggtggtggcagcggcaaggctttt
aactgggagttgctggaaccattaagtacagaggagcgtcaacgttgtctgttagccgga
ggcattggccctgaaagcatcagcagtgcaatagagttaggctttgccggagtggacatt
aactctcaagccgaatggaaacctggcattaaaaatagccaaaaagtagctcaaacattc
acgaaaatccgccattatggtcgtttttcagaaaaacatctttcaaataagaatacccaa
caggaggctgtatga

DBGET integrated database retrieval system