KEGG   Idiomarina loihiensis L2TR: IL1754Help
Entry
IL1754            CDS       T00218                                 

Gene name
trpC
Definition
(GenBank) Anthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ilo01100  Metabolic pathways
ilo01110  Biosynthesis of secondary metabolites
ilo01130  Biosynthesis of antibiotics
ilo01230  Biosynthesis of amino acids
Module
ilo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IL1754 (trpC)
Enzymes [BR:ilo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     IL1754 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     IL1754 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: AAV82587
UniProt: Q5QX81
Position
1888552..1890006
Genome map
AA seq 484 aa AA seqDB search
MSDTIRLEKNVLKTIVERKVEQNKTQAELMPLSEIKSQLRPSDRSLYEALSGEQAGFILE
CKKASPSKGLIRADFDAPQLAKSYQPYAAAISVLTEPEFFQGRLDYLTAVRRQVTQPVLC
KDFFIDEEQVYRARYFGADAILLMLSVLDDAQYIALRDIAESLAMDVLTEVANEEEMKRA
AKLDANIIGINHRDLTDLSIEPNRSAQLAPLAPQNALLIAESGFAEHADIRRVAPFVNGF
LIGSALSAQPDVDLACRKLLYGQNKVCGLTRAEDAINARSQGAVFGGLIFVERSPRCVTL
KQAKQITTEANGLEYVGVFADQPLESLIDTAKYVGLSAIQLHGHEDIDYVVQLRQQLRQA
GLEAVKIWKALAIESPAQLPDLAVDAFVLDNRGGGSGKAFNWELLEPLSTEERQRCLLAG
GIGPESISSAIELGFAGVDINSQAEWKPGIKNSQKVAQTFTKIRHYGRFSEKHLSNKNTQ
QEAV
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccattcgtttagaaaagaacgtgctgaaaacgatcgttgagcgcaaggtt
gagcagaacaaaactcaggccgagctcatgcccctgagtgaaataaagtctcagctcaga
cccagtgaccgtagcttatatgaagcattaagcggtgagcaggcaggttttattctggag
tgtaaaaaagcctctccttcaaaaggtttaattcgtgctgactttgacgcaccacagttg
gcaaaaagctaccagccttatgccgcagctatttccgtattaaccgagcctgagtttttt
caggggcgactggactatctgacagccgtgcgccggcaggttacccagccggttttatgc
aaagacttttttattgatgaagagcaagtttaccgcgcccgctactttggtgcggatgct
attttgcttatgttatcagtcctggatgatgcgcaatatatcgccctgcgcgatatagct
gagtcacttgcgatggatgtactcaccgaagttgccaacgaagaagaaatgaaacgtgcc
gcgaaactggacgcaaacatcattggcattaaccaccgcgatttaacagacttgagcatt
gagccgaaccgcagtgcgcagttagctccgctggctccccaaaatgccttactcattgca
gagtcaggttttgctgagcacgccgacattcgccgggttgccccttttgttaacggcttt
cttatcggcagcgcattgagcgcccagccggacgttgatttagcctgccgcaaactgctt
tatggacaaaataaagtttgcggtctgactcgcgctgaagatgccataaacgcacgttct
cagggtgcggtattcggcgggctaatatttgttgagcgttcacctcgttgtgtgacactg
aagcaggcaaagcaaataacaactgaagcaaacggacttgagtatgtgggtgtttttgct
gatcaaccgttagagagccttatcgacacggcaaaatacgtcgggctctctgctattcaa
ctgcacggccatgaagatatcgactatgttgttcaattacgtcagcaattgcgtcaggca
ggtctggaagcagtaaaaatatggaaagctttagctattgaaagcccggcacagttgccg
gatcttgcggttgatgcatttgttctggataaccgcggtggtggcagcggcaaggctttt
aactgggagttgctggaaccattaagtacagaggagcgtcaacgttgtctgttagccgga
ggcattggccctgaaagcatcagcagtgcaatagagttaggctttgccggagtggacatt
aactctcaagccgaatggaaacctggcattaaaaatagccaaaaagtagctcaaacattc
acgaaaatccgccattatggtcgtttttcagaaaaacatctttcaaataagaatacccaa
caggaggctgtatga

DBGET integrated database retrieval system