KEGG   Idiomarina loihiensis L2TR: IL1755Help
Entry
IL1755            CDS       T00218                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    IL1755 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IL1755 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IL1755 (trpB)
Enzymes [BR:ilo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     IL1755 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1890003..1891226
Genome map
AA seq 407 aa AA seqDB search
MSQSLPAYFGDFGGQFVPEILLPALEQLEQAFIEAQQDDDFQAEFRGLLKNYLGRPTPLS
LCRNLPLNSPNKTKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGTA
TALACALLDLECIIYMGKKDVERQQPNVFRMELMGAKVVPVDTGSGTLKDAVNEALRDWT
ASYPNTHYLLGTAAGAHPFPTIVREFHRMIGEEAKAQIIEQAGRLPDEVIACVGGGSNAI
GMFADFIDEEGVDLVGVEPAGKGVETKQHGATLAAGKPGILHGCLSFLMQNDEGQIEESY
SVSAGLDYPGVGPQHAHLKAIGRARYESVTDEEALEAFKLLSRHEGIIPALEPAHALAYA
LKRAAEPDAPEILLLNLSGRGDKDIDHVRRIFSAQENAEVSAKGEQK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtcattacccgcttattttggcgatttcggcggccagttcgttcctgagatc
ttactacccgcactagagcagttggaacaggcctttatagaggcacaacaggacgatgac
tttcaggctgaatttcgcggattgttgaaaaactacttaggcagaccgacaccactgagt
ttgtgccgtaacctgccgctgaacagcccaaataaaaccaaaatttatcttaaacgtgaa
gatttacttcatggcggcgcccacaaaaccaaccaggtgctgggacaagcgttactggct
aagcgcatgggtaaaacgcgcattattgcagaaactggtgcagggcagcacggcaccgca
acagccctggcctgcgcactgctggacctggaatgcattatttatatgggcaaaaaagat
gttgagcgccagcagcccaatgtcttccgtatggaattaatgggcgcaaaagtggtacct
gtggataccggtagcggtactctaaaagatgcggtcaatgaagctctgcgtgactggaca
gcaagttatcccaacacccactacttattaggaacagctgcaggcgcacaccccttcccg
actatagtgcgtgaatttcaccgcatgattggtgaagaagctaaagcccaaattatcgag
caagctggtcgcttaccggacgaagttattgcctgtgtcggcggcggatccaacgccatt
ggcatgttcgccgactttatcgacgaggaaggtgttgatttagtaggtgttgagcctgca
ggtaaaggtgttgaaaccaagcagcacggcgctacgctggctgcgggtaaacccgggatt
ttgcatggttgtctatcgtttttaatgcaaaacgacgaaggacaaattgaggagtcctat
tcagtatcagccggtctggactaccccggcgtgggccctcaacatgcgcatttaaaagct
attggtcgggcgcgatacgaatcagtaaccgatgaagaagcactggaagcctttaagctg
ctctcccgccatgaaggcattattcctgcgctggaacctgcccatgcgctggcttacgcg
ctaaaacgagccgcagaaccagatgctccggaaatattactacttaacttatccggccgc
ggtgataaagacattgaccacgtacgtcgtatttttagtgctcaggaaaatgctgaagtt
agcgcgaaaggagaacaaaaatga

DBGET integrated database retrieval system