KEGG   Idiomarina loihiensis L2TR: IL1756Help
Entry
IL1756            CDS       T00218                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    IL1756 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    IL1756 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    IL1756 (trpA)
Enzymes [BR:ilo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     IL1756 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1891223..1892032
Genome map
AA seq 269 aa AA seqDB search
MSRYESCFAQLKANNQGAFVPFVTLGDPTPGQSVDVIKALIDGGADALELGLPFSDPVAD
GPMIQRANLRALESGTTFKHILEILKEIRDYSPQIPIGLLVYANLIYAKGVRNFYQQMKD
AGVDSVLIADVPTKEAKRFADIAKEIGIEAVFIAPPDASDALLIDIAKQCAGYVYLLSRS
GVTGADTQMQAPASELINKLKEAGAPPTLLGFGISQPEHVQRALAAGADGAISGSAVVAL
IEKNLDNNAQQVADLKAFVKSMKAATQLS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccggtatgaaagctgtttcgcacaattaaaagctaataaccagggtgctttcgtt
ccttttgtgacacttggagacccaactccggggcaaagtgtggacgttatcaaggctctt
attgatggtggtgccgatgcgctggaattgggtctgccattttcagacccggttgctgat
ggtcccatgatccagcgggcaaatttacgagccttagagtcgggaacaacctttaagcat
attttagagattttaaaagaaattagagactattcaccgcagatacccataggcttattg
gtttacgcaaacttaatctacgcgaaaggtgttcgcaacttttaccagcaaatgaaagat
gcaggcgtagattcagtgcttattgctgatgttccgaccaaagaagccaaacgcttcgcc
gacatagccaaagaaattggaattgaagcggtgtttattgcgccaccagatgccagtgat
gcgctattaattgatatcgcgaagcaatgtgcgggttatgtctacctactgagtcgttca
ggggttaccggtgctgacacacaaatgcaggcccccgcttcggaactgattaataaactg
aaagaagcaggtgccccgccaacgttgcttgggtttggtatatcccagccggaacatgtt
cagcgagcgctagcagcaggcgcagacggtgccattagtggttcggctgtggttgcgctt
atcgagaaaaacctcgacaataacgcgcagcaagtagcggacttaaaggcttttgtaaaa
agcatgaaggccgcaacccaattgtcgtag

DBGET integrated database retrieval system