KEGG   Idiomarina loihiensis L2TR: IL1835Help
Entry
IL1835            CDS       T00218                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ilo01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ilo00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967524..1968852
Genome map
AA seq 442 aa AA seqDB search
MSELRIPIEQWQSLSSAEQTQRLARPGRAQAESLREKVAVILSDVRDNGERAVLNYTRQF
DNPDATSLRMSDEQVEAAVASLDDKVKRAIDTAYQTIYRFHEAQRPQDLSIETAPGVQCE
LRYAPLDAVGLYIPGGSATLPSTALMLGVPAQIAGCQRVVMVSPPNKQGELPAALLYAAK
RCGVTDILLCGGAQAIGALAYGIESSPAVGKVFGPGNSFVTEAKQQVSQNDSGCAMDLPA
GPSELLVIADDSANPAYVAADLLSQAEHGPDSQVILLTPSMTVAENVRQELMAQCAQLSR
ADIAEQALQASRLLVVADMNEAIAISETYAPEHLSIQTDNARDLLPQLTRAGSVFVGHYT
PESGGDYATGTNHVLPTYGYARNYSSLGLVDFYRRYTVQEASHDGLRQLAEAITTLADVE
GLDAHKRAVTIRTETKSTESKL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaattacggatacccattgagcaatggcaaagcctgtcgtcagcggagcaaact
caacgcttagcgcgccccggacgggctcaggcagaatcactgcgagagaaggttgcagtt
attctgagtgacgttcgtgataacggtgagcgcgcggtactgaactatacccgccagttc
gataacccggatgcgacctcattgcgaatgagcgatgaacaggtggaagcagccgttgct
agtttagatgacaaagtaaaacgcgccatagacactgcgtaccaaaccatttatcgcttt
cacgaagcgcaacgtccgcaggacttaagcattgaaaccgcgccaggcgtgcaatgtgaa
ctgcgttatgcgccgttagacgccgtcggtttatacattcccgggggcagcgcaaccttg
ccctctaccgcattaatgctgggtgtacccgcgcaaattgccgggtgccagcgtgtggtt
atggtcagcccgcctaataaacagggcgaattaccagccgccctgctctacgctgctaag
cgttgcggcgtaaccgatattctcctgtgtggcggcgctcaggctattggtgcgctggcg
tacggtatagagtcatcgcctgctgtaggtaaagtctttggcccgggtaacagctttgtt
accgaagccaagcaacaggttagccagaatgacagcggttgtgccatggatttaccggca
ggcccctcagagctgttggtgattgctgatgacagtgcaaacccggcctatgtggcggcg
gatttactgtcacaagccgagcacggaccggattctcaggttattttgcttacgccctca
atgacggtcgccgaaaatgtacggcaggaactgatggcacaatgcgctcagctaagtcgc
gccgatattgccgagcaggccttacaggccagtcgtctgctggtagttgccgatatgaat
gaagccatagccattagcgaaacctatgcgcccgaacacctttctattcagacggataac
gcgcgtgatctactgccacagttgacccgtgcaggctctgtctttgtcggacactacaca
ccagagtccggcggtgattatgccaccggtaccaaccacgtgctgccaacctatggctat
gcccgcaattacagcagccttgggctggtcgacttctaccgtcgttatacggtccaggaa
gccagtcacgacggactacgccagttagcagaagccattactactttggctgacgttgaa
ggtttagatgcgcacaaacgtgccgtgactattcgtacggagactaaaagtacggagagc
aaactatga

DBGET integrated database retrieval system