KEGG   Idiomarina loihiensis L2TR: IL1847Help
Entry
IL1847            CDS       T00218                                 

Gene name
recR
Definition
(GenBank) Recombinational DNA repair protein
  KO
K06187  
recombination protein RecR
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    IL1847 (recR)
DNA repair and recombination proteins [BR:ilo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     IL1847 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      IL1847 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1979124..1979729)
Genome map
AA seq 201 aa AA seqDB search
MSISPAIDQLVENLKRLPGVGQKSAQRMAFHLLERDRGGASRLAESLQSAVEKVGHCECC
RTLTEEPLCRICSNPMRRENGVLCIVETPADVLAIEQTSQFQGRYFVLMGHLSPLDGIGP
ADIGLDELERQLQSEPVEEIVLATNPTVEGDATAHYIADIAAQLNINTTRIAHGVPVGGE
LGYVDQTTLGHAFSGRKQFSR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtattagtccggcaatcgatcaactggtcgagaatttaaaacgtctaccgggtgtt
ggccaaaagtcagcacagcgtatggcgttccatttgcttgagcgcgatcgcggtggagcc
tcaaggcttgccgagtctttgcagtcggcggtggaaaaagtcggccactgcgagtgttgc
cggaccttaaccgaagaacccttgtgtcgcatttgcagcaatcctatgcggcgcgaaaat
ggtgtgctttgtattgttgaaacacccgccgacgtattagccattgaacagacctctcaa
tttcaggggcgttattttgtgctgatggggcatttgtctccgctggatggtattgggccg
gcggacattggtctggatgagctggagcggcaactgcagagcgagccggtggaagaaatt
gtgctggcgactaacccgactgtggaaggggatgctaccgcgcactatattgccgacatt
gccgcgcaattgaatatcaacaccacccgaattgctcacggggtgccagtaggcggtgag
ctgggttatgtcgatcaaaccacactgggtcacgccttcagtggccgaaaacaattttcc
cgatga

DBGET integrated database retrieval system