KEGG   Idiomarina loihiensis L2TR: IL1882Help
Entry
IL1882            CDS       T00218                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    IL1882 (deoA)
Enzymes [BR:ilo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     IL1882 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014244..2015584)
Genome map
AA seq 446 aa AA seqDB search
MFLAQEVIRKKRDAVSLSDTDIQQFVNGICDDSVSEGQIAALAMAIYFRGMSAQEKTALT
VAMRDSGDVLDWRQDNLNGPVLDKHSTGGVGDVVSLMLGPIVAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTAPDNRRFRDTVKQAGVAIIGQTGRLAPADSRFYATRDVTATVESI
PLITASILAKKLAEGLDGLVMDVKAGNGAFMPGYDESRELAQSLVSVGRKLGVETTALIT
DMNQALGSAAGNAVEVQLAVDYLTGKRRDKRLHQVTKALSAELLVSGNLAKSTDQAEVMV
ENVLGSGLAAERFAKMVGSLGGPHDFLEKSDQYLPQANLRKPLKLPAEYHGLYLSEVNTR
ELGMAVVCLGGGRRKADDKLDLSVGMTDILTVGSKVDSESVIATVHASNESDWQEAADSI
LKALSFSSTPPEPDSVIYERIAGETE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggcgcaagaagttattcgcaaaaagcgtgacgctgtaagtttatccgacacc
gatattcagcagttcgttaacggaatttgcgatgatagcgtcagtgaggggcaaatagct
gcgttggctatggctatttattttcgcggtatgtcggcgcaggaaaaaacagctttaacc
gttgctatgagagattccggcgatgttcttgactggcgacaggacaatttaaatggtccg
gtattggataagcactcaaccggcggtgtcggtgacgtcgttagtttaatgctgggtcct
attgtcgcagcctgtggtggctatgttccgatgatttcggggcgtggtctgggacatact
ggcggtacgctggataaatttgacgccatccccggctatcagaccgcgccggataatcgg
cgctttcgcgacacggttaagcaggctggtgttgccattattgggcaaacagggcgtctg
gcaccagctgatagccgcttttacgcaacgcgcgatgtgaccgcgacagtggagtcgatt
ccgttaattacagcttctattctggcaaaaaagctggctgaaggccttgatggtttggtt
atggatgttaaagccggtaacggtgcattcatgccaggatacgatgagtcgagagagtta
gcgcagagtctggttagtgttggccggaaactgggagtagaaaccacggcgcttattact
gacatgaatcaggcattaggttcagctgccggtaatgcggttgaggttcagttagccgtc
gattatttaacgggaaagcgcagagataaacgcctgcatcaggtaacaaaagccttatct
gctgagttgctggtgtcgggaaacttggctaaaagtactgaccaagctgaggttatggtt
gaaaacgtactgggaagcggtttggcggcggaacgtttcgccaaaatggtcggttctttg
ggtggacctcacgactttctggaaaaaagcgaccagtacctgccccaggcaaacctgaga
aaaccgttaaagcttcccgccgagtatcatgggctatatttatcggaagtgaatacaaga
gaattgggaatggcggttgtctgtttaggtggaggccggcgcaaagctgatgataaattg
gatttaagcgttggtatgaccgatatcctgacagttggatcgaaagtggactcagagagt
gtcattgcaacagtgcatgccagtaacgagtcggactggcaagaggctgctgacagcata
ctgaaagctttgagtttttcctctaccccgccggagcccgactctgttatctatgagcgc
atagccggagagactgaatga

DBGET integrated database retrieval system