KEGG   Idiomarina loihiensis L2TR: IL1949Help
Entry
IL1949            CDS       T00218                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IL1949 (holC)
   00240 Pyrimidine metabolism
    IL1949 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    IL1949 (holC)
   03430 Mismatch repair
    IL1949 (holC)
   03440 Homologous recombination
    IL1949 (holC)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     IL1949 (holC)
DNA replication proteins [BR:ilo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     IL1949 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2074566..2075015
Genome map
AA seq 149 aa AA seqDB search
MSSATFFLMPDEAEDEQNRLICDKIAQLYRKHKKLRVWARNQQQAEALDELLWQQPSDAF
IPHNLHGEGPATGAPVEFCWPEADAVKNRPGYALFNLAEEIPVQAQQSQQLYDIVPADDN
GKKTARERYKHYRARGCQMQTEPLTSEQK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagccacctttttcttaatgccggacgaagctgaagatgagcaaaaccggctt
atctgcgataagatagcgcaactgtaccgaaagcataaaaagttgcgggtctgggcgcgt
aatcagcagcaggctgaagctttggacgaactcttgtggcaacaaccaagtgatgctttt
attccgcataacttacacggcgaaggcccggccactggtgctccggtagagttttgctgg
cctgaggcggatgcagtaaaaaaccgtccgggttatgcactgtttaacctggcggaagag
attccggtacaagcccagcagagccaacagctctatgacattgttccagccgatgacaat
ggcaaaaaaacagctcgcgagcgttacaaacattacagggcgcgcggttgccaaatgcaa
accgagcccctgacatccgaacagaagtaa

DBGET integrated database retrieval system