KEGG   Idiomarina loihiensis L2TR: IL1967Help
Entry
IL1967            CDS       T00218                                 

Gene name
folK_2
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IL1967 (folK_2)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     IL1967 (folK_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2100538..2101047)
Genome map
AA seq 169 aa AA seqDB search
MAQVFLGIGSNTDREKHIRAGLKAIAKSFTWQQRSRIFRSASVGFSGSDFYNLVVEVITN
LSVTEVLAECKRIEQENGRIPGSAKFSPRTLDIDVLLYDDVIREQQPQLPRGEILENAFV
LWPLAEIAGHHLHPLLNVSYEQLWEQYQQTHKDSPQQLEPISDTSWLEG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaagtttttctcggaataggttctaatacggatcgtgaaaaacatattcgggca
gggttgaaagccattgcaaagagctttacctggcaacaacgctcaagaatttttcgcagt
gcctcggtagggttttccggaagtgatttttacaatctggtggtggaggtaataaccaac
ctttctgttaccgaagttctggctgaatgcaagcgcattgagcaggaaaacggacggatt
ccgggcagtgctaagttcagcccgcgaacattagacattgatgtcttattgtatgatgac
gttattcgggagcaacaaccgcagttgccccgtggcgaaattcttgaaaatgcctttgtg
ctctggccactggctgaaatagccgggcaccacctgcatccgcttttaaatgtgagttac
gagcagttgtgggagcaataccagcagactcataaagactcaccgcaacaattagagcct
attagcgacacttcttggctggaaggttaa

DBGET integrated database retrieval system