KEGG   Idiomarina loihiensis L2TR: IL2011Help
Entry
IL2011            CDS       T00218                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ilo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:ilo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2153917..2155224)
Genome map
AA seq 435 aa AA seqDB search
MKLKALAAGIGLALASTMVQAEEQKPNIIYIIGDGMGFEYISAYRYAMSDLDSKTIAETE
FDAMLKGAATTYPDDNTWVTDSAAGATALATGVKSYNGAIAVDSDKYPLQSIMELARENG
WSTGSVSTSQVNHATPASFFTHHPSRYEYNQIADKIATQVVEGKPSFDVMLGGGQSYFNR
DDKNWLDVLPEHGMQVVTDMQKLNSVDSTPVMGLFAEKGLPFAIDGDVDALANMTRTALR
LLDKKQQPFALMIEGSEIDWCGHANDIACAVHEMDGLNRALKVVSEYRENNPNTLIVMTA
DHSTGGLTLGRDGEYAWHSDRVMKIKSSIASMSKEMLTMDTDSWAEYVADKVNFELTQEY
LDELAIAAEKEGEEQQEALHQALVYITGDITGTGWTTSGHTGVDVPVFADGPYSENFGGY
MDNTDIGKQLIKVVK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaaagcactggcagccggtattggactggcgttggcatctacaatggtgcag
gcagaagaacagaaacccaatattatttatattattggtgacggtatgggatttgaatat
attagcgcgtaccgttatgccatgtctgatttagacagcaaaacgattgctgaaactgag
tttgatgccatgctgaaaggcgccgcaacaacctatcctgatgataatacctgggttact
gactcagctgcgggtgcaaccgctctggctacaggcgttaaaagttacaatggcgctatt
gcggtcgattcagataaatatccgctgcagagtatcatggaactggctcgtgaaaatggc
tggtcaacgggttcggtatcgacatcacaagttaatcatgcaacaccggcatcgtttttc
actcatcacccgtcgcgctacgaatataatcaaatagccgacaaaattgcgactcaggtg
gttgaaggtaagccgtcttttgacgtcatgctaggtggcggacaaagctattttaaccgt
gacgacaaaaactggctggatgtattgccagagcatggcatgcaggtagtaaccgatatg
caaaagctaaactcggttgactctacgcctgtaatggggctttttgcagaaaaaggtctg
ccgtttgctattgatggcgatgttgatgcgttggccaatatgacacgtaccgctttgcgc
ttattggataaaaagcagcagccgtttgctttaatgattgaaggcagcgaaattgactgg
tgtggtcatgctaacgacattgcttgtgccgtacacgaaatggacgggctaaaccgcgcc
ttgaaagtggtgagtgaataccgcgaaaacaaccccaataccttaattgttatgacggct
gatcactcaactggcggtctgacactagggcgtgacggcgagtatgcctggcattctgac
cgtgttatgaaaattaaaagctctattgcgtccatgagtaaggaaatgctgaccatggat
acggatagctgggcggagtatgtagctgacaaagttaactttgagctgactcaggagtat
cttgatgaacttgctattgctgctgaaaaagaaggtgaagagcagcaggaggctctgcat
caggcattggtctatataacgggcgatattaccggcactggctggacaaccagcggacac
accggcgttgatgttcctgtcttcgccgacggcccgtatagcgagaacttcggtggctat
atggacaatactgatattggcaagcagctaataaaagtcgttaaataa

DBGET integrated database retrieval system