KEGG   Idiomarina loihiensis L2TR: IL2176Help
Entry
IL2176            CDS       T00218                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    IL2176
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    IL2176
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IL2176
Enzymes [BR:ilo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     IL2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2321366..2323060
Genome map
AA seq 564 aa AA seqDB search
MKQFNRRDFLKLFAATGAAVTVSTALQGCASVGKTSERSSVKFDHGVASGDPTSNAILLW
TRAVPENTAEKQVTLGWELAADENFSSIIRSGTATTSASRDYTVKVDVTQLSPNQRYYYR
FLGKNSKSPSGKTQTLPESGLKPLKFAVFSCSNYPAGYFNPYSEAAKDDSIDAVIHLGDY
IYEYGAGGYATQGSQEIGRGLPDNNNTELFTLTDYRRRYALYRTDEGLQALHAHAPFIAV
WDDHEISNDTWKNGAENHQEDEGSFIERRAAAVQAYYEWLPIRPPQGEANLTIYRDFKFG
DLVDLIILDTRVIGRDKQLNYDDYRDAESGQFNTQKFQQDMSSDRSIMGKKQLQWLVNKL
NNSSARWQVLGQQLLMGKMNFPAAAFAADDRSKVTPLLLQIAELKKRLQNGEELTAQQQA
MVTQVTPYNLDAWDGYPIEREMLYRAAQKANKQLVVIAGDTHNAWHSELRSSDGAHIGVE
FATSSVSSPGMETYLSLDTKTAEQLAKALPTLIEDLKYTNLHQRGYMNLFASEDAVEAEW
VFVDTIRSKDYRVVNKHRARYTGS
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaatttaaccgacgtgactttttaaagctatttgcagcaacgggcgcagcagtc
accgtatcaaccgcattacagggctgtgcaagtgttggcaaaaccagtgagcgcagctcc
gtcaagtttgaccatggcgtagccagtggcgatccaacttcaaacgccattttgttgtgg
acgcgcgccgtgccggaaaataccgcagaaaaacaagtaacgctgggctgggaactggcc
gccgatgaaaacttttcaagtatcattcgttctggaacagccacaacaagcgccagcaga
gactacacagttaaagtcgacgttactcaattatcgccaaaccagcgttactactatcgt
tttttaggtaagaacagcaaaagcccctctggcaaaacgcaaacgcttcctgaatctggc
ttaaaaccgctgaagtttgcggttttctcctgctctaactaccccgccggttactttaac
ccatactccgaagcagcaaaggacgattctattgatgcggtcattcatttaggtgactac
atttacgagtatggcgcaggcggttacgccacccaaggttcgcaagaaattggccgcggc
ttacccgacaacaataatacagaactttttaccctgactgattatcgtcgccgctacgcg
ctttaccgcaccgacgaagggttacaggcactgcacgcacatgccccttttattgccgtg
tgggatgaccatgaaattagcaatgacacctggaaaaacggtgcagaaaaccaccaggaa
gatgaaggcagctttattgaaagacgcgcagccgcggttcaggcgtactatgagtggctg
cctattcgtccgccacagggcgaagccaacctcactatttatcgtgatttcaaattcggt
gacttagttgatttgatcatactggatacccgcgttatcggacgtgataaacagctgaat
tatgacgactaccgcgatgcagaaagcggtcagttcaatacccaaaaattccagcaggac
atgtcttctgaccgcagcatcatgggcaaaaagcagttacagtggctggttaataaactg
aataacagctcagcgcgctggcaagttttaggtcaacaattgcttatggggaaaatgaac
tttcctgcggccgcattcgcggcagatgaccgcagtaaagtcacaccactgctgttacaa
atagcagagcttaaaaagcgcctgcagaacggcgaagagctaacagcacagcaacaggca
atggtcactcaggttactccctataaccttgatgcatgggacggttaccccattgaacgt
gaaatgctctaccgggcggcgcaaaaagccaataaacaactggtggttattgccggtgac
actcataacgcgtggcacagcgaactgcgcagttcagacggagctcacattggggtggag
tttgccacgtcttcggtatcatctccgggaatggaaacttacctaagtctggacacaaaa
actgcagaacagctggcaaaagcacttcctacgcttatagaagacttaaaatataccaac
ctgcatcagcgcggttatatgaacctctttgcatccgaggacgcggtagaagcggaatgg
gtattcgtggacacgattcgcagcaaagactatcgggtagtgaataagcacagagcgcgc
tatacgggaagttag

DBGET integrated database retrieval system