KEGG   Idiomarina loihiensis L2TR: IL2432Help
Entry
IL2432            CDS       T00218                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ilo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2604992..2605996)
Genome map
AA seq 334 aa AA seqDB search
MKQPPTTQQRPADDTPEWLEFFKAQVEVFWEQQVTSEYFAAFDGLKLHFAYYRHSDSAPL
VVIAPGRIESALKYQELFWELAQQGFSVAALDHRGQGLSGRLTANPHQGHVENFNDFVRD
FSDFTNLLVARFGDVPKTLFSHSMGGTIATIYCATYQHPYKKLILSAPMFSIETGIVPYW
FARWIVFAGAWLNRWLAKPWYFLGMGNYKPVPFEENVLTHSRQRYKAFRDAYDNVSDVQL
GGPTFNWLYEAISAAINAQKLANDITISVILFQAGNDKVVSASGQKKVAAAVTRDHFRFE
TIKGASHELMMETDKFRQPVLDALIEETRKLANA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccgcctactacacaacaacgccctgcagacgacacgcccgaatggctggag
ttttttaaggctcaagtcgaagtcttttgggaacaacaagttacctctgagtattttgct
gcgtttgatggtctcaaattacattttgcctattaccgacatagtgactccgcaccctta
gtggttattgctccggggcgaatagagtcggcactgaagtatcaggaactgttttgggag
ctggcacagcagggcttttctgttgcggcactggatcaccgtgggcagggattgtcgggg
cgcctgacggcgaaccctcatcagggacatgtcgaaaactttaatgactttgtacgtgac
ttttcggactttaccaacctgttagtggcacgatttggcgatgtacccaaaacactgttt
tctcactcgatgggcggaacaatagcgaccatttactgtgccacttaccagcatccttat
aaaaaactcatactctctgctcctatgttttctatagaaacaggaatagtgccttattgg
ttcgcgcgttggatagtttttgcgggagcctggttaaaccgctggctggcaaaaccgtgg
tattttctcggtatgggaaattataagccggtgccttttgaagagaacgttctgacacat
agccgacagcgatataaggcgtttcgggatgcttatgataatgtttcggatgttcagcta
ggcgggcccacatttaattggctgtatgaggccatcagtgccgctatcaacgcgcagaaa
ctggcaaatgacattaccatttcggtcattctgtttcaggcagggaatgataaagtggtt
tccgcgtcaggacaaaagaaagtagctgctgcggttacccgggaccactttaggtttgag
accattaaaggtgcatcgcacgagcttatgatggaaactgacaagtttcgtcaacctgtg
ctggacgctcttattgaagaaacccggaaacttgctaacgcttaa

DBGET integrated database retrieval system