KEGG   Idiomarina loihiensis L2TR: IL2432Help
Entry
IL2432            CDS       T00218                                 

Gene name
pldB
Definition
(GenBank) Lysophospholipase
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IL2432 (pldB)
Enzymes [BR:ilo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     IL2432 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 PAF-AH_p_II
Motif
Other DBs
NCBI-ProteinID: AAV83264
UniProt: Q5QYM1
Position
complement(2604992..2605996)
Genome map
AA seq 334 aa AA seqDB search
MKQPPTTQQRPADDTPEWLEFFKAQVEVFWEQQVTSEYFAAFDGLKLHFAYYRHSDSAPL
VVIAPGRIESALKYQELFWELAQQGFSVAALDHRGQGLSGRLTANPHQGHVENFNDFVRD
FSDFTNLLVARFGDVPKTLFSHSMGGTIATIYCATYQHPYKKLILSAPMFSIETGIVPYW
FARWIVFAGAWLNRWLAKPWYFLGMGNYKPVPFEENVLTHSRQRYKAFRDAYDNVSDVQL
GGPTFNWLYEAISAAINAQKLANDITISVILFQAGNDKVVSASGQKKVAAAVTRDHFRFE
TIKGASHELMMETDKFRQPVLDALIEETRKLANA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccgcctactacacaacaacgccctgcagacgacacgcccgaatggctggag
ttttttaaggctcaagtcgaagtcttttgggaacaacaagttacctctgagtattttgct
gcgtttgatggtctcaaattacattttgcctattaccgacatagtgactccgcaccctta
gtggttattgctccggggcgaatagagtcggcactgaagtatcaggaactgttttgggag
ctggcacagcagggcttttctgttgcggcactggatcaccgtgggcagggattgtcgggg
cgcctgacggcgaaccctcatcagggacatgtcgaaaactttaatgactttgtacgtgac
ttttcggactttaccaacctgttagtggcacgatttggcgatgtacccaaaacactgttt
tctcactcgatgggcggaacaatagcgaccatttactgtgccacttaccagcatccttat
aaaaaactcatactctctgctcctatgttttctatagaaacaggaatagtgccttattgg
ttcgcgcgttggatagtttttgcgggagcctggttaaaccgctggctggcaaaaccgtgg
tattttctcggtatgggaaattataagccggtgccttttgaagagaacgttctgacacat
agccgacagcgatataaggcgtttcgggatgcttatgataatgtttcggatgttcagcta
ggcgggcccacatttaattggctgtatgaggccatcagtgccgctatcaacgcgcagaaa
ctggcaaatgacattaccatttcggtcattctgtttcaggcagggaatgataaagtggtt
tccgcgtcaggacaaaagaaagtagctgctgcggttacccgggaccactttaggtttgag
accattaaaggtgcatcgcacgagcttatgatggaaactgacaagtttcgtcaacctgtg
ctggacgctcttattgaagaaacccggaaacttgctaacgcttaa

DBGET integrated database retrieval system