KEGG   Idiomarina loihiensis L2TR: IL2489Help
Entry
IL2489            CDS       T00218                                 

Definition
Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    IL2489
   00565 Ether lipid metabolism
    IL2489
   00590 Arachidonic acid metabolism
    IL2489
   00591 Linoleic acid metabolism
    IL2489
   00592 alpha-Linolenic acid metabolism
    IL2489
Enzymes [BR:ilo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     IL2489
    3.1.1.32  phospholipase A1
     IL2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2667746..2668777
Genome map
AA seq 343 aa AA seqDB search
MKKWIWIIASGVTALAAVNVQAQELSDMQQCLLDEMNNTKADATIADIRSTCEEQLRSAE
NDEDIVEVDAVEDPGALTSRMKSEQVTQFDPYVLTPHRRNYLLPVITTNNINRLQYADVE
GYEQNLEDYEAKFQLSFKVPFNKESLLFEDDQLFFGLTVQSWWQVYSSNISKPFRETNYM
PEVFYATSTGWHPFGTNTALVFGLEHLSNGRSQPLSRSWNRGYMQFVVEKGRFVFSLKPW
LRFQEDAKTDPMQSSGDDNPDITDYVGDYEFTTAYNDGDFEYILRLRHAVDTGRGSAELN
WTFPIGGKFIGYTSIFTGYGESLIDYNHKQTRFGIGIALNNIL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggatctggataattgcatcgggagttaccgcactagcggcggttaatgtc
caggcgcaagaactgtctgatatgcagcaatgtctgctggatgaaatgaacaacactaag
gctgacgccaccattgcggatattcgctctacctgcgaagaacaactgcggtcagctgag
aatgacgaagatatagtggaagtcgatgcggttgaagaccccggtgctttaaccagccgc
atgaaaagcgaacaagttacccagtttgacccttatgtattaacaccgcaccgtcgtaac
tatttattacccgttattaccacgaacaacattaaccgcctgcaatatgccgatgttgaa
ggttacgagcagaacctggaagactatgaagcaaagttccaattaagtttcaaagtgcct
tttaacaaagaaagtttgctgtttgaagacgaccagttgttttttggcttaaccgtgcag
tcctggtggcaggtgtattccagtaatatttctaaaccattccgcgaaaccaactacatg
cccgaggttttttatgccacttcaaccggctggcacccttttggtaccaataccgcgtta
gttttcggtttagagcatttgtctaatgggcgtagccagccattgtcacgcagctggaac
cgcggttacatgcaatttgtggtagaaaaaggccgcttcgttttctcgctgaaaccctgg
ttacgttttcaggaagacgccaaaacagaccccatgcaatcgagtggtgacgacaacccg
gatattaccgattacgtgggtgactatgaattcaccaccgcctataacgatggtgacttc
gagtacattctcaggctccgccatgccgtggataccggcagagggtcggcagagcttaac
tggacattccctattggcgggaagtttattggctatacctcaattttcaccggttacgga
gagagcctgattgactacaatcacaagcagactcgctttggtatcggtatagccttaaac
aacattctataa

DBGET integrated database retrieval system