KEGG   Idiomarina loihiensis L2TR: IL2530Help
Entry
IL2530            CDS       T00218                                 

Gene name
recD
Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ilo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2706753..2708696)
Genome map
AA seq 647 aa AA seqDB search
MTEVTSNTLFDALREWRDAGWIRSIDLAFVEFLQQAGETRSEVLLAALCASHEAGRGHTC
IDIKALQNEPESVLNLPPENRYSPNCVNPSELFRQFGTDVEAALIQSHCVDVDGKGNQPL
VLSDGKLYLRRYWQYEAFIENDLQARMSDRPVTNDDLLKSTLAKLFDKPDGDKAEEINWQ
RVACANTVRNRFSVITGGPGTGKTYTVVRLLTALQHQTLFLGLPPLRVSLAAPTGKAAAR
LTESIESELNRLRGDAKLATLKDALDAIKPEGKTLHRLLGVKPNSRAFKHHADNPLRTDV
VIVDEASMIDIEMMTALLKATPKNARLVLIGDKDQLASVEAGAVLGNLCEGADQGHYHTE
TAQWLQHVADTPVLPAELIDNNGEQRLQHVVKFRKSYRFHGPIADLANAINRQDNAATKQ
ELEKAKVADEDYPVSLYEVSSLDDPAFEALVKRNLTTSGSLTLHVRNNADTNSNVTKTAN
AEDINKLAQEALQNLSNFQILTALREGPWGVKAVNQKVGEILGVNANTWYEGRPVMVTKN
DYGLKLNNGDIGLTFKDPEHGHLRVAFPDQTNKSENKGVRWVLPSRLTHIETVYAMTVHK
SQGSEFKHTVMVLPDHDSPVLSKELLYTGITRAKERLSLVGSGLKVI
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagtaacctcaaacaccttatttgatgcgctgcgtgagtggcgtgatgccggc
tggatacgctcaatagacctggcctttgtggagtttttgcagcaagccggagaaacgcgc
agtgaagtattactggctgccctgtgtgcctcgcacgaagccggtcgcgggcatacctgt
attgacataaaggctctgcagaatgaacccgaaagcgtactgaatttaccgcccgaaaac
cgctattcgccgaactgcgttaatcctagcgaattgttccgtcagtttggtacggatgtt
gaagcggcattaattcaaagtcactgcgtagacgtcgacggaaaaggcaatcagccgctg
gtgttaagtgacggcaaactgtatttgcgtcgttactggcaatacgaagcctttatagag
aatgatttacaggcgcgcatgagcgaccggccagttaccaacgacgacttactgaaaagc
acgctggccaagttgtttgataaacctgacggtgacaaagccgaagagattaactggcag
cgcgtggcctgcgctaacaccgtgcgcaaccgctttagcgtcataaccggcgggcccggt
accggtaaaacctacaccgtcgtgcgcctgttaactgcgttgcagcatcagactttattc
ctcggcctaccgccgctgcgcgtatcgttggcagcgcctaccggtaaggccgccgcgcga
ctcactgagtccatagaaagcgagctgaataggctgcggggtgatgcaaagctcgccacc
ctgaaagacgccttagacgccataaaacctgaaggtaaaacgctgcaccggctgctgggt
gtaaaaccgaactcgcgcgcgtttaaacaccacgccgacaacccactgcgcacagacgtt
gtgatagtcgacgaagcctcaatgatagacattgaaatgatgaccgcgctgctaaaagcc
acacccaaaaacgcgcggctggtgcttattggtgacaaagatcagctcgcttccgtagaa
gccggcgcagtgctgggcaatttgtgtgaaggcgcggaccaaggccactaccacacagaa
accgcccagtggttacagcacgttgccgacacacctgttttgcccgcggagttaatagac
aacaatggcgagcaacgcctgcaacacgtggtgaaattccgcaaaagctaccgttttcac
ggccctattgccgacctggctaacgccattaaccgacaagacaacgccgcaacaaaacag
gaactggaaaaagccaaagtcgccgatgaagactaccccgttagcctgtacgaagtcagc
agcctagacgatccagccttcgaagctttggttaaacgtaacctgacgacctcgggtagc
ctgacgttacacgtcaggaacaatgccgacaccaacagcaatgttactaaaaccgccaac
gccgaggacatcaacaaactcgcccaggaagccctgcaaaacctaagcaacttccaaatc
ctgaccgccctgcgcgaaggcccctggggcgtaaaagccgttaaccaaaaagtcggcgag
atactcggcgtaaacgccaacacctggtacgaaggtcgtcccgttatggtcaccaaaaac
gactacggactgaagctgaacaacggcgacattggcctaacctttaaagaccccgaacac
ggccacctgcgcgtcgcctttcccgaccagaccaacaagtctgaaaataaaggcgtgcgc
tgggtattacccagccgtctcacccacatagaaaccgtgtacgccatgactgtacataaa
tcgcagggctctgaattcaaacacaccgttatggtgttgcccgaccacgacagccccgtg
ctaagtaaggagttgctgtatacggggattacgcgggctaaggagcggttgagtttggtg
gggagtggattaaaggttatttag

DBGET integrated database retrieval system