KEGG   Ipomoea nil (Japanese morning glory): 109181771Help
Entry
109181771         CDS       T04663                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109181771
   00500 Starch and sucrose metabolism
    109181771
Enzymes [BR:ini01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109181771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 584 aa AA seqDB search
MALSSQKLGWVFLLCFVVFCGYKNGVVVVEASHKVYMHLQSQSAVDIKKVHRTGYHFQPP
QHWMNDPNGPMYYKGLYHLFYQYNPKGAIWGNIVWAHSVSKDMINWKPLKPAIYPSKPFD
QFGTWSGSATILPGNKPAILYTGIVDNKETQVQNLAYPKDYNDPYLQEWVKPDFNPIVIG
DTPWMNISAFRDPTTAWLGRDGHWRMVVGSKRKRRGVAYLYRSRNFVDWVKAKHPLHSAP
QTGMWECPDFFPVQAQGKTGLDTSVLGENVKHVLKVSLDETRYEYYTVGAYYPDIDRFIP
DRNSVDGWAGLRFDYGNFYASKTFFDPSKNRRVLWGWSNESDVSPDDSEIKGWSGVQAIP
RRIWLHSNGKQLVQWPIEELETIRENKVELNNHKLNIGENIEVKGITAAQADVEVTFSFK
SLDKAEPFDPTWADYDAQKLCSVRGSTVQGGLGPFGLATLASTNLEEFTPVSFRVFKDQH
KYKVLMCSDATLSTLRNEPRMYKPSFAGFVDVDLAVEKKLSLRSLIDHSVVESFGAGGKT
CITSRVYPTLAIYDNAHLFAFNNGTEAITIETLNAWSMGNPKMN
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgtcgtcccaaaagcttgggtgggtttttctgctttgttttgtggttttctgc
ggctacaaaaatggcgtcgtcgtcgtcgaagcctctcacaaggtttatatgcatctgcaa
tcccaaagcgccgttgatatcaagaaagttcatcgtaccggttaccactttcaaccccca
caacattggatgaatgatccaaatggtccgatgtattacaaaggactgtaccatcttttc
taccaatataacccgaaaggggcaatttggggaaacatagtatgggcccattcagtgtcc
aaagacatgattaactggaagccgttaaagcccgcaatctacccgtcaaagccctttgat
caatttgggacatggtcgggctcggccaccattctccccggtaacaagcccgcaatcttg
tacaccggaattgtggacaacaaagaaacccaagtccaaaacttggcttacccaaaggac
tacaacgacccgtaccttcaagaatgggtgaagcccgacttcaacccgattgttattggg
gatacaccctggatgaacatttcggcgtttcgtgacccaaccacggcctggttgggccgg
gatggtcattggcggatggtggtgggctccaagagaaagcgaagaggggtagcttatttg
tataggagcagaaactttgtggattgggttaaggcaaaacacccattgcattcagctccc
caaaccggaatgtgggagtgcccggatttcttcccggttcaggctcaggggaaaaccggt
ttggatacttcggttcttggggagaatgttaagcatgtgttgaaagttagtcttgatgag
acaaggtatgagtactacactgtgggtgcatattatccggatatagaccggttcattcct
gataggaattctgttgatggttgggccgggttgaggtttgattatggcaacttctatgca
tccaagactttctttgatcccagcaagaaccggagggttctttggggctggtctaatgaa
tccgatgttagcccggatgatagtgaaataaagggttggtctggagttcaggctattcca
cgtagaatctggcttcattctaatggaaaacaactggtgcaatggccaattgaagaactg
gaaaccattagagagaacaaagtcgaactgaacaatcacaagctgaacattggagagaat
attgaagttaagggaatcacagctgcacaggctgatgttgaggtgactttctccttcaaa
agcttagacaaggcagagccatttgaccccacctgggctgattatgatgcacagaaactc
tgtagtgtaaggggttcgacagtccaaggtggtctgggaccatttgggctggcaacctta
gcttcaacgaacttggaagagttcacacctgtttccttcagagtgttcaaggaccaacac
aagtacaaagtgctcatgtgctcagatgcaacattgtcgactttgaggaatgaaccaaga
atgtacaaaccctcatttgctggatttgtagatgtagatctagctgtagagaagaaactg
tcacttaggagtctgattgatcattcagtagtagagagttttggtgcaggtggaaaaacc
tgcattacatctagagtttatcctacattggcaatctatgataatgctcacttgtttgca
ttcaacaatggcacagaggcaattactatagagactttgaatgcatggagtatgggtaat
cctaaaatgaactaa

DBGET integrated database retrieval system