KEGG   Ipomoea nil (Japanese morning glory): 109188027Help
Entry
109188027         CDS       T04663                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    109188027
   00500 Starch and sucrose metabolism
    109188027
Enzymes [BR:ini01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109188027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 575 aa AA seqDB search
MGATSKLWLFPMSFLLLVYGGVETQASHIVLQSLEALHPPFPNQTYRTSFHFQPPRNWMN
DPNGAMVYKGLYHIFYQYNPNGAAFGNISWGHSTSKDLVNWRAHSLALSPSQPYDINGAW
SGSATILRSGEPALLYTGNDSRNRQVQNLAVPKTPSDPYLQEWVKSARNPLISPNRYNMI
NATSFRDPTTAWLGLDGDWRIVIGSKVERRGLAILYRSKDFVDWVEAEQPLHSAEGTGMW
ECPDFYPVSAGNPTGLDTSSYGPGIKHVLKVSLDDSKHEYYTIGTYDRVEDKYIPDTESV
DNGSGLRYDYGKFYASKTFYDSLKRRRILWGWINESLPESEYVKQGWSGVQGIPRIVWLD
EPGKQLLQWPIQEIKKLRSGRVEIPSTMLENGSVAEVSGISAAQADVVVKFKIMEFEKAE
KMEEGWTDPQELCRQKGASVRGGIGPFGLKVLASENMQEYTAVFFRVFKGRNNNNPVVLM
CSDQTRSSLNKKTDKTSYGAFVDIDPMQKELSLRILIDHSIVESFGAKGKVCITSRVYPT
EAIGEKAHLYAFNYGVHTIKLSNLTAWSMKTPIIN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccacctctaaactttggctattccccatgtctttcctcttgttagtctatgga
ggtgttgaaacccaagcctcacacattgttctacaaagccttgaagccctccacccacct
ttccccaaccaaacttatagaacatctttccatttccaacctcctaggaattggatgaat
gatcctaatggggcaatggtttataaagggctataccacatattctaccaatacaaccca
aatggtgcagcttttggcaatatatcatggggacactctacttcaaaagacctagttaac
tggagagctcatagtcttgccctctctccatcccagccgtacgatataaacggtgcatgg
tccggttcagcgacgattctccggtccggcgagccggccttgctctacaccggcaacgat
tcaagaaaccggcaggttcaaaacttggccgtgcccaaaaccccatccgacccgtacctc
caagaatgggtaaaatcagcccggaatccattaatctcgccaaacagatacaacatgatc
aatgctacgtcgtttagggaccccacgacggcctggctaggcctcgacggggattggaga
atcgtaatagggagcaaagttgagcgccggggattagctatcctgtataggagtaaggat
ttcgttgactgggtcgaagccgaacagcctcttcattcagctgaaggaacaggaatgtgg
gagtgtcccgatttctatcccgtttctgctggtaacccaaccggcctggacacttcatcg
tacggtcccgggatcaaacatgtattgaaagtgagcctggatgactctaagcatgaatac
tacacaatcggaacgtacgaccgtgtcgaggataagtatatcccggatacagaatccgtg
gataacggctccggcttaagatacgattatggcaagttttatgcgtccaagacgttttat
gacagcttaaagagacgaagaatcctctggggatggattaacgaatccttgccagaatct
gaatatgttaaacaaggatggtctggagttcagggaattccaagaattgtttggcttgat
gaacctggaaaacagctgcttcaatggccaattcaagaaataaaaaagttacgttcaggg
agagttgagattcctagtaccatgctcgagaacggatctgtagcagaggtttcaggaatc
agtgccgcacaggcggacgtggttgtaaaatttaagataatggagtttgagaaggcagaa
aaaatggaggaaggatggacagatcctcaagagttatgcaggcagaagggagcatctgta
cgaggaggaatagggccgtttgggttgaaggttttggcttcagaaaacatgcaagaatac
acagcagtgttcttcagagtcttcaaaggaagaaacaacaataatcctgtcgtgctcatg
tgcagtgatcaaaccaggtcttcactgaacaagaagacagataagaccagctatggagca
tttgtggatatagatcctatgcaaaaagaattatcactcaggatcttgattgaccattcc
atagtggagagctttggtgcaaaaggaaaggtttgcattacttcaagggtttatccgaca
gaggctattggtgagaaggcacacttgtatgcattcaattatggagtccacaccattaaa
ctctccaatttgacagcttggtccatgaaaacaccaatcatcaactga

DBGET integrated database retrieval system