KEGG   Isosphaera pallida: Isop_0045Help
Entry
Isop_0045         CDS       T01407                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ipa  Isosphaera pallida
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ipa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ipa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ipa00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59503..60822
Genome map
AA seq 439 aa AA seqDB search
MAQAAVPVVVPNAGESITEGILARWIKPNGSFVQAGDDVCEIETDKTTNPAKASVSGILI
WKAQEGDTVQIGAIIGEIDPSAQPVVSTVPASDSPASSSVAASGSSTSSVNVNGGASVPP
MTPAGRRIAAELGVNPAEVTATGRHGLVTKPDVIAHLAGRVDAPASPPPTPAPIPAPTPA
PATLTPPTSTPTPAFATGPVAATGPGRPREIRERMSGLRQKIAQRLVEAQHTAAILTTFN
EADLSRVIELRTKYKESFQKKHGISLGFMSFFIKAAVDALKTYPRVNGRIEGNEIVINQV
YDIGVAVSTERGLMVPVIRDADQKGFATLEKELAAYATRARENKIDVADLQGGTFTITNG
GVFGSLLSTPILNPPQSGILGMHAIQKRPVVLDDQVVIRPMMYLALSYDHRIIDGREAVG
FLVRIKECVENPERMLIDI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagccgccgtccccgtcgtggtgcccaacgccggggagtcgatcactgaaggc
atcctcgcccgctggatcaaaccgaacgggtcgttcgtccaagcgggcgacgatgtgtgc
gaaattgaaaccgacaagaccaccaaccccgccaaagccagcgtttcgggcattttgatt
tggaaggctcaggagggggatacggtgcaaatcggcgcgatcatcggcgaaatcgatccg
tccgcccaacccgtcgtctcgacggtgcctgctagcgattcccccgcctcgtccagcgtc
gccgcatccgggtcctccacgagttcggtcaacgtcaacggcggcgcgtctgttccgccg
atgactccagcgggccgccgaattgccgctgaattgggggtcaaccccgccgaagtgacc
gccaccggtcgtcacggcctagtcaccaaacccgacgtgatcgcccacttggccggccgc
gttgatgcccccgcctcccccccacccacgcccgcgccaatccccgctccgacgcccgcg
cctgcgacgttgacgccgccgacatcgactcccacgccggccttcgccaccggtcccgtg
gcggccaccggcccagggcgaccccgcgaaatccgcgaacgcatgtccggcctgcgtcag
aagatcgcccaacgtctggtcgaagcccagcacaccgctgccatcctgaccaccttcaac
gaggccgacctctcccgcgtgatcgaactgcgaaccaagtacaaagaatcgttccagaaa
aagcacggcatcagcctgggcttcatgtcgtttttcatcaaggccgccgtcgatgccctc
aagacctatccccgcgtcaacggccggatcgaaggcaatgagatcgtcatcaaccaggtg
tacgacatcggggtggcggttagcactgaacgcggcctgatggtgccggtcatccgtgac
gccgaccaaaaagggttcgccaccctggaaaaggaactggccgcttacgccacccgcgcc
cgcgagaacaagatcgacgtggccgaccttcagggcggcaccttcaccattaccaacggc
ggtgtcttcggctcgctgctgtccaccccgatccttaacccgccccaaagcggcatcctc
ggcatgcacgccatccagaaacgcccagtcgtcctcgacgatcaggtcgtcatccgtccc
atgatgtacctggcgctctcctacgaccaccggatcatcgacggtcgcgaagcggtcggc
ttcctagtccgcatcaaggaatgcgtcgaaaaccccgagcggatgctgatcgacatttga

DBGET integrated database retrieval system