KEGG   Isosphaera pallida: Isop_0045Help
Entry
Isop_0045         CDS       T01407                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ipa  Isosphaera pallida
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_0045
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isop_0045
  Amino acid metabolism
   00310 Lysine degradation
    Isop_0045
Enzymes [BR:ipa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Isop_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
59503..60822
Genome map
AA seq 439 aa AA seqDB search
MAQAAVPVVVPNAGESITEGILARWIKPNGSFVQAGDDVCEIETDKTTNPAKASVSGILI
WKAQEGDTVQIGAIIGEIDPSAQPVVSTVPASDSPASSSVAASGSSTSSVNVNGGASVPP
MTPAGRRIAAELGVNPAEVTATGRHGLVTKPDVIAHLAGRVDAPASPPPTPAPIPAPTPA
PATLTPPTSTPTPAFATGPVAATGPGRPREIRERMSGLRQKIAQRLVEAQHTAAILTTFN
EADLSRVIELRTKYKESFQKKHGISLGFMSFFIKAAVDALKTYPRVNGRIEGNEIVINQV
YDIGVAVSTERGLMVPVIRDADQKGFATLEKELAAYATRARENKIDVADLQGGTFTITNG
GVFGSLLSTPILNPPQSGILGMHAIQKRPVVLDDQVVIRPMMYLALSYDHRIIDGREAVG
FLVRIKECVENPERMLIDI
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagccgccgtccccgtcgtggtgcccaacgccggggagtcgatcactgaaggc
atcctcgcccgctggatcaaaccgaacgggtcgttcgtccaagcgggcgacgatgtgtgc
gaaattgaaaccgacaagaccaccaaccccgccaaagccagcgtttcgggcattttgatt
tggaaggctcaggagggggatacggtgcaaatcggcgcgatcatcggcgaaatcgatccg
tccgcccaacccgtcgtctcgacggtgcctgctagcgattcccccgcctcgtccagcgtc
gccgcatccgggtcctccacgagttcggtcaacgtcaacggcggcgcgtctgttccgccg
atgactccagcgggccgccgaattgccgctgaattgggggtcaaccccgccgaagtgacc
gccaccggtcgtcacggcctagtcaccaaacccgacgtgatcgcccacttggccggccgc
gttgatgcccccgcctcccccccacccacgcccgcgccaatccccgctccgacgcccgcg
cctgcgacgttgacgccgccgacatcgactcccacgccggccttcgccaccggtcccgtg
gcggccaccggcccagggcgaccccgcgaaatccgcgaacgcatgtccggcctgcgtcag
aagatcgcccaacgtctggtcgaagcccagcacaccgctgccatcctgaccaccttcaac
gaggccgacctctcccgcgtgatcgaactgcgaaccaagtacaaagaatcgttccagaaa
aagcacggcatcagcctgggcttcatgtcgtttttcatcaaggccgccgtcgatgccctc
aagacctatccccgcgtcaacggccggatcgaaggcaatgagatcgtcatcaaccaggtg
tacgacatcggggtggcggttagcactgaacgcggcctgatggtgccggtcatccgtgac
gccgaccaaaaagggttcgccaccctggaaaaggaactggccgcttacgccacccgcgcc
cgcgagaacaagatcgacgtggccgaccttcagggcggcaccttcaccattaccaacggc
ggtgtcttcggctcgctgctgtccaccccgatccttaacccgccccaaagcggcatcctc
ggcatgcacgccatccagaaacgcccagtcgtcctcgacgatcaggtcgtcatccgtccc
atgatgtacctggcgctctcctacgaccaccggatcatcgacggtcgcgaagcggtcggc
ttcctagtccgcatcaaggaatgcgtcgaaaaccccgagcggatgctgatcgacatttga

DBGET integrated database retrieval system