KEGG   Isosphaera pallida: Isop_0741Help
Entry
Isop_0741         CDS       T01407                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ipa  Isosphaera pallida
Pathway
ipa00010  Glycolysis / Gluconeogenesis
ipa00052  Galactose metabolism
ipa00500  Starch and sucrose metabolism
ipa00520  Amino sugar and nucleotide sugar metabolism
ipa00521  Streptomycin biosynthesis
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01130  Biosynthesis of antibiotics
ipa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_0741
   00052 Galactose metabolism
    Isop_0741
   00500 Starch and sucrose metabolism
    Isop_0741
   00520 Amino sugar and nucleotide sugar metabolism
    Isop_0741
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Isop_0741
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Isop_0741
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Isop_0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADV61332
UniProt: E8R1R0
Position
complement(1048289..1049302)
Genome map
AA seq 337 aa AA seqDB search
MVSREREQGSAQAAEGPFWLGIDLGGTNIKSGVVDDQGHPLSSVCRPTEAEKGPAVGLIN
LAEAGRQAVAEAGLTLDQIAGVGLGSPGLMDIHAGLLIDPPNLPGWTNLPIRRLLEEKLG
RPTAFQNDANAAAFGEFWVGAGREVESLVLFTLGTGVGCGIIDNGRLIEGRHSHGAECGH
IIIQMEGGREWPPGYFGRLEAYASATALVKRAVEALDRDRNLTTSLRTLLAQDNLSSRTI
FEAADAGDALAKRLVRETARYLAVGAVNLMHTIDPDMVLFAGGMIAAGPSFLEQIRADIR
EMAFPIPARATRIEYAALGVDAGFIGAAGWARFKFKP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccgggagcgggaacaagggtcggcgcaggcggcggaaggtccattctggttg
ggcatcgacctgggaggcaccaacattaaaagcggtgtggtggacgaccaggggcatccc
ctctcctcggtttgccgacccaccgaggcggaaaaggggcccgcagtgggattgatcaac
ctggccgaggcgggccgccaagccgtggctgaagccggattgactttggaccagatcgcc
ggagtcggtttgggatcgcccggacttatggacattcacgccgggttgttgatcgatccg
cccaacctgccgggctggaccaacctgccgatccgccggttgctcgaagagaagctgggg
cgtcccaccgcgtttcaaaacgacgctaacgccgccgccttcggcgagttctgggtcggg
gccggccgcgaggtggaaagccttgtcctcttcaccctaggtaccggggtcggctgcggc
atcatcgacaatgggcgtctcatcgaagggcggcactcccacggggccgaatgcggccac
atcatcatccaaatggagggcggccgcgaatggcctcccggctacttcggacgcctggaa
gcctatgcctcggccaccgcgttggtcaaacgcgctgtcgaggcgctggatcgggaccgc
aacctgacgaccagcctacgaaccctgctggcccaggacaacttgtcaagccgtaccatc
ttcgaggccgccgacgccggcgacgcgctggccaagcgtctggtgcgcgaaacggcccgc
tacctggcggtcggcgcagtgaatctcatgcacacaatcgacccggacatggtgctgttc
gcgggcgggatgatcgccgcgggtccttccttcctggaacaaattcgggccgatatccgc
gaaatggccttccccatacctgcccgcgccactcggatcgaatatgccgccctgggagtt
gacgccggcttcatcggcgcggccggctgggcccggtttaagttcaagccatga

DBGET integrated database retrieval system