KEGG   Isosphaera pallida: Isop_1077Help
Entry
Isop_1077         CDS       T01407                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_1077
   01230 Biosynthesis of amino acids
    Isop_1077
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_1077
   00030 Pentose phosphate pathway
    Isop_1077
   00051 Fructose and mannose metabolism
    Isop_1077
   00052 Galactose metabolism
    Isop_1077
  Energy metabolism
   00680 Methane metabolism
    Isop_1077
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Isop_1077
Protein phosphatases and associated proteins [BR:ipa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Isop_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549145..1550461
Genome map
AA seq 438 aa AA seqDB search
MSASSPPEPSPTTNRVIRKVAILFAGGPAPAANAVISTAAASFLRNGIEVVGILHGYSHL
VEFGPDHPMQEGRDVLTITNRTLRRTRNSRGILIGTARTNPGKSVNSPADLADPVKTAPL
KTIHDALSSLNVDALVSIGGDDTLKTANKFQKFQRYLPADARRIAVVHVPKTIDNDYSGI
DFTFGYFTAVDTLAREILNLLADAEATRCYYLVETMGRSAGWLAYGAAIAGEASLVLSVE
DIVGKYRAEETYEDPKTGETKTRPVMNINEVIKWVVAAMRTRDRDGKPFGVIVLAEGLAE
LLPSEMLKGIPRDDHGHISISQVNLGKTFAKLVANEYRSQTGKDRKVNGLQLGYEARCAQ
PHAFDVMLGSQLGVGAYRALVERGLDGVMVSVSGQLDLTYVDFDKLVDPETLVTKVRFIE
KDSDFQKLARFLETQVQY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctcgtccccgccggagccctcccccaccaccaaccgcgtcattcgcaaagtg
gccattctcttcgccggaggaccggctccggcggccaacgccgtcatttccaccgccgca
gcctcgttcctccgcaacggcatcgaagtggtgggtattctgcatggatactcccatctc
gtcgagtttggcccggatcatccgatgcaggaaggccgagatgtgctgaccatcacgaat
cggaccctgcggcgaacccgcaacagccgggggattctcattggcaccgcccgtaccaac
cccggcaagtcggtcaactcgcccgcggatctggccgacccagtcaagactgccccgctc
aaaaccatccacgacgccctcagttcgctcaacgtcgatgccctggtctcgattggcggc
gacgacacgctcaaaaccgccaacaagtttcaaaagttccaacgctatctgccggccgac
gctcggcggatcgccgtagtccacgtccccaaaaccatcgacaacgactactccggcatc
gacttcaccttcggttacttcaccgccgtcgataccctcgcccgcgaaatcctcaacctg
ttggctgacgccgaagccactcgctgctactacctcgttgaaaccatgggacgctccgcc
gggtggttggcctacggcgcggccatcgccggcgaagcctcgctggtcctctcggtggag
gacatcgtgggcaaatatcgcgccgaagaaacctacgaagaccccaagaccggtgaaacc
aaaactcgccctgtgatgaatatcaacgaagtcatcaagtgggtggtcgccgctatgcgg
acccgcgaccgggacgggaaaccttttggggtgatcgtgctggccgaaggtctggccgaa
cttcttccctcggagatgctcaaaggcatcccccgcgacgatcacggccacatctccatc
tcccaggtcaacttgggcaaaaccttcgccaagctcgtcgccaacgaataccgaagccag
accggcaaagatcgcaaagtcaatggccttcagctcggttacgaagcccgttgcgctcaa
cctcacgccttcgacgtgatgctgggcagccaactcggagtcggcgcttatcgcgcgttg
gtcgaacgagggttggacggcgtgatggtttccgtctccggccagcttgatctcacctac
gtcgatttcgacaagctcgtcgatcccgagaccctagtgaccaaggttcgcttcatcgag
aaggattccgactttcaaaagctggctcgcttcctcgaaactcaagtgcagtactga

DBGET integrated database retrieval system