KEGG   Isosphaera pallida: Isop_1374Help
Entry
Isop_1374         CDS       T01407                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ipa  Isosphaera pallida
Pathway
ipa00260  Glycine, serine and threonine metabolism
ipa00750  Vitamin B6 metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_1374
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Isop_1374
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Isop_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADV61959
UniProt: E8QXB8
Position
1984233..1985528
Genome map
AA seq 431 aa AA seqDB search
MNASSDSGDSGSLVAGLRCRLCGTLYPARPINFCPEDFGPLEVDYHHDAVARTFNRAAIA
SRPRTMWRYRELLPLDGPPTVGTQVGCTPLVRADRLAKVLGVSELYIKNDAVNHPTLSFK
DRVVAVALSKAVEFGFKTVGCASTGNLAGSVAANAAAAGLEAYVLIPDNLEAGKILGATV
YGAKVIAVSGNYDQVNRLCSQIAFKYGWGLVNVNLRPFYAEGSKTMGFEIAEDLGWCAPD
HVVAPMAGGSLIGKIYKAFKELEKHGLIGPVSTRMYGAQASGCNPIAALVKSGGKRIKPV
RHPNTIAKSLAIGDPADGDFAASLIHATGGWSEDVSDEEIVAGMRLLAQTEGIFAETAGG
VTVAAARRLIQDGKIDRDGSTVLCITGNGLKTQEALIDHVARPQVIPPNLAAFEELVGLA
PVDSAGLVAAS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgtcgtcggattcgggagattcgggttcgttggtggcaggactgaggtgccgc
ttgtgcggcactctgtatccagcccgccccatcaacttctgccccgaggacttcggcccg
ctggaggtcgattaccatcacgacgcggtggctcgcaccttcaaccgcgcggcgattgct
tcccgtccccgcaccatgtggcgctatcgggaactcctcccgttggacggcccgccgacc
gtgggcacccaggttggttgcacccctctggttcgagccgaccgtctggccaaggtcctg
ggggtctctgagctttacatcaaaaacgacgcggtcaaccatcccaccctctctttcaaa
gatcgagtggtcgccgtggcgctctccaaggcggtcgagttcggcttcaagaccgtcggc
tgcgcctcgaccggcaacctcgccggctcagtggcggccaacgccgcggctgctgggttg
gaagcatatgtgttgatccccgacaacctggaagccggaaaaatcctcggggccaccgtc
tacggtgccaaggtgatcgccgtttcggggaactatgaccaggtcaaccgtctttgttcc
cagatcgccttcaaatacggctggggcctggtgaatgtcaacctgcgtcccttctacgcc
gaaggctccaagacgatgggcttcgagatcgccgaagacctgggttggtgtgcgccggat
catgtggtcgcgcccatggccggtggcagcctcatcggcaagatttacaaggcgttcaag
gaactggaaaagcatgggctaattggaccggtcagcacgcggatgtatggcgctcaggcg
tcgggctgcaacccaatcgccgcgttggtgaagtcgggcggcaagcggattaaaccggtt
cgccaccccaacaccatcgccaagagccttgcgattggcgaccccgccgacggcgacttc
gccgcgtcgctgattcacgccactgggggctggagcgaggatgtcagcgacgaggaaatt
gtcgccgggatgcggctgctggcccaaaccgaagggatcttcgccgaaaccgccggcggc
gttaccgtcgcggccgcacggcgtctgatccaagacggcaagatcgaccgcgacggctcg
accgtgctttgcatcaccggcaacggtctcaaaacccaagaagcgctgatcgatcacgtg
gcccgtccccaggtcatcccgcccaacctcgccgccttcgaggaactggttggtctggca
cccgttgattcggccggcttggtcgctgcctcttaa

DBGET integrated database retrieval system