KEGG   Isosphaera pallida: Isop_1510Help
Entry
Isop_1510         CDS       T01407                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ipa  Isosphaera pallida
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Isop_1510
   00051 Fructose and mannose metabolism
    Isop_1510
Enzymes [BR:ipa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Isop_1510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179174..2180487
Genome map
AA seq 437 aa AA seqDB search
MAEFFPDVPKIRYGGPTSKNPLEFKHYNPDEVVAGKTMRDHLRFSVVYWHTFTNPLSDPF
GVGTAVRPWDDGTKTVENAQRRVRAAFEFFEKLGVPYYAFHDRDVAPEGASLKETNAILD
QVVKVLKEEQQRTGVKLLWGTANLFSNPRYMHGAATSPHLDSFAFAAAQVKKAMEVTLEL
GGEGYTFWGGREGYSTLLNTDLKRELDHLGRFLHMAVDYKKSIGFTGQFYIEPKPKEPTK
HQYDSDAAACLNFLRQYNLLDHFKLNLETNHATLAGHEMMHEMVTAIAAGALGSIDANTG
DPLLGWDTDQFPTSVYLTAQCMGCILDMGGFTTGGVNFDAKVRRESFEPIDLFYAHIGGM
DAFARGLKIADALRRDGRLSQFLAQRYRSWDSDLGRKIEAGQTGFADLETYILAKGDVAP
MESGRQELLENIVNEFI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattttttccggacgtgcccaaaatccgatatggtggtcccacgtccaaaaac
cctcttgagttcaaacactacaatcccgatgaggtggtcgcaggcaagacgatgcgcgac
catctccggttttcagtggtttactggcacaccttcaccaatcccctatccgacccattc
ggcgtgggcacggcggttcgtccctgggacgacggcaccaaaaccgtggaaaacgcccaa
cgccgcgttcgcgccgccttcgaattcttcgagaagctcggcgtcccatattacgccttc
catgaccgcgacgtggcccccgagggagcgtcgctcaaggaaaccaacgcgattctggat
caagtggtgaaggttctcaaagaggaacaacagcgcaccggcgtcaagctgctttgggga
accgccaaccttttttccaacccgcgttacatgcacggggcggccaccagtccgcatctc
gactcgttcgccttcgccgccgctcaggtcaagaaggcgatggaggtgaccctggagctt
ggaggtgaaggctacaccttctggggggggcgggaaggctactcaaccctgctcaacact
gacctgaaacgcgagttggatcatctgggacgattcctgcacatggcggtggattataaa
aagtcgattggtttcaccggtcaattctacattgagcccaaacccaaggaacccaccaag
caccagtacgactccgacgcggctgcttgcttgaacttcctccgtcagtacaacctactg
gaccacttcaaactcaacctcgaaaccaaccacgccaccctggccggtcacgagatgatg
cacgaaatggtcacggcgatcgccgctggagcgttggggtcgatcgacgccaacaccggc
gatccgctgttgggctgggacaccgaccaattccccacctcggtgtatctgacggcacaa
tgcatgggctgcatcctcgacatgggcggtttcaccaccggcggggtcaacttcgacgcc
aaggtgcgccgcgaaagcttcgagccaatcgatctgttttacgcccacatcggcgggatg
gacgccttcgcccgcggcctcaagatcgccgacgccctacgtcgggatggtcgcttgagc
cagttcctcgcccaacgttaccggagctgggattcggacctgggccgcaagatcgaggca
ggccaaaccgggttcgccgacctggaaacctacatcctggccaaaggggatgtggctcca
atggagtcgggtcgccaagagttgctggagaacatcgtcaacgagttcatttga

DBGET integrated database retrieval system