KEGG   Isosphaera pallida: Isop_1622Help
Entry
Isop_1622         CDS       T01407                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ipa  Isosphaera pallida
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Isop_1622
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Isop_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2363316..2364197
Genome map
AA seq 293 aa AA seqDB search
MRIWIGMGSNMGDRWEHLTAARAALAALPGVQLEAFSRFWSNPPIGGPQGQGTFLNAAAQ
LRLDDEANPKLSWLERAEWLLDQLQAIERQRGTAKTTRWDQRPLDLDLLLVGPEQVGSSA
RLRIPHPRMTHRRFVLVPLHEIAPHVAIPPLNRTVADLLTHLDRQPRIATIVGPDAPRFA
QRLLDHLAHPIPPPNWIIRPLINDPNPPVPPSQITLIIHSQVVPPLRGHNHDHSLPEGWE
TIPQVRPEFDPLAEALAALASLDAAVIPASEQSHSPIADSLPPSFPAQEPGAG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatctggatcgggatgggcagcaacatgggtgaccgttgggaacacctaacggcc
gcccgcgccgctttggcggcgctcccgggagttcagctcgaagccttcagccgcttttgg
tccaatccaccaatcggcggtccccagggccagggcaccttcctcaacgccgccgcccaa
cttcgactcgacgacgaggccaaccctaagctgtcctggctcgaacgcgctgagtggctg
ctggaccaacttcaggcgatcgaacgccaacgcggcaccgccaaaaccacccgctgggac
caacgcccactcgacctcgacctccttttggttggtcccgagcaggtcggctccagcgcg
cgtcttcgcattccccacccccgcatgacccatcgccggttcgtcctggttccactccac
gagatcgccccccacgtcgcaatcccccccctcaaccgaaccgtcgccgacttgctgacc
cacctggatcgacagccccgaatcgccacgatcgtcggtcccgacgcccctcgcttcgct
caacgcctgctcgaccacctggcccatccaattcccccccccaactggatcatccgcccg
ctcatcaacgatcccaaccctccggttcccccctcccaaatcaccctgatcatccactcc
caggtggttcccccgctccgcggccacaatcacgatcactcccttccagagggttgggaa
accatccctcaagtccgccccgaattcgaccccctggccgaagccctcgccgcgctcgcg
tcgctcgacgcagccgtcatccccgcgtccgaacaatcccattccccaatcgccgactct
ctcccaccctcgttccccgcgcaggaacccggtgcaggatga

DBGET integrated database retrieval system