KEGG   Isosphaera pallida: Isop_1684Help
Entry
Isop_1684         CDS       T01407                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ipa  Isosphaera pallida
Pathway
ipa00020  Citrate cycle (TCA cycle)
ipa00640  Propanoate metabolism
ipa00660  C5-Branched dibasic acid metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01130  Biosynthesis of antibiotics
ipa01200  Carbon metabolism
Module
ipa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ipa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isop_1684
   00640 Propanoate metabolism
    Isop_1684
   00660 C5-Branched dibasic acid metabolism
    Isop_1684
Enzymes [BR:ipa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Isop_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADV62268
UniProt: E8R0E1
Position
complement(2456702..2457970)
Genome map
AA seq 422 aa AA seqDB search
MNIHEYQAKALLKAAGAAVPAGEPATSAEEAARIYDVLGGGLMVVKAQVHAGGRGKGVAV
KPSDPSNPVADLATAYEIACGRAAAPEGVRRGVKLVRSREEARQVAEGLLGATLVTYQTG
PSGSPVHTVLVTVGHDIDRELYLGMTVDRTLKCPVLIASTEGGVDIETVAAQTPEKIHRE
PIDVGLRLRDFQARKVARALGLTGAAAKNGQKFLAALVDLFLDKDVALAEINPLIVTKDH
QVLALDAKISFDDNALFRHPEIAAMRDVQEEDPAELRAAQAGLSYVSLDGDIACLVNGAG
LAMSTMDIIKYHGGAPANFLDVGGGASKEQVQEGFRILLASPRVKAVLVNIFGGIMRCDT
IAGALLAAYDELQFNLPLVVRLEGTNVKEGKALLEQSGRPIITADGLTDAAQKVVAAAKG
QT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtatcaggccaaggcgttgctcaaggcggccggagcggcggtgccc
gcgggcgaaccggcgaccagcgccgaggaggccgcccggatttacgacgtgttgggcggc
gggttgatggtcgtcaaggctcaggttcacgctgggggtcggggtaagggtgtggcggtc
aagccgtcggacccatccaatccggtggctgatctggccaccgcttacgagatcgcctgc
gggcgggctgcggcacctgaaggggtcaggcgtggggtcaagctggtccgcagccgcgag
gaagcccgccaggtggccgaggggttgctgggggccactctggtcacctatcagactgga
cccagcggcagcccagttcacactgtgttggtgacagtcggccacgacattgaccgggaa
ctgtatctcgggatgaccgtggaccgcacccttaagtgtccggtgttgatcgcctcgacc
gagggcggggtagacatcgagaccgtcgcggctcaaaccccggagaagattcaccgcgag
ccgatcgacgtggggctgcgtctgcgtgacttccaggcccgcaaggtcgctcgcgccctg
ggactgactggcgcagcggccaagaacggtcagaaattcctggccgcgttggtcgatttg
tttctggacaaggatgtggcgctggctgaaatcaacccgctgatcgttaccaaggaccac
caagtgctggcgttggatgccaagatcagctttgacgataatgcgttatttcgtcatccc
gagattgccgcgatgcgggatgtgcaggaggaggatccagcggagttgcgagcagctcag
gcggggttgtcctatgtgagtttggacggcgacattgcctgtctggtcaacggggccggt
ttggcgatgtccacaatggacatcatcaagtatcacggcggcgctccggccaacttcttg
gacgttggcggtggggccagcaaggagcaggtgcaggagggcttccggattttgctggct
tcgccgcgggtcaaggcggtgctggtgaacatttttggcggcatcatgcgatgcgacaca
atcgcgggggcattgttggccgcctacgacgaattgcagttcaacctgccgttagtggtt
cgtctggaagggaccaacgtcaaggagggcaaggcactgttggaacaatcaggtcgtccg
atcatcaccgccgacggtttgaccgacgcggctcaaaaggtagtcgcagccgccaagggc
caaacctga

DBGET integrated database retrieval system