KEGG   Isosphaera pallida: Isop_1684Help
Entry
Isop_1684         CDS       T01407                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ipa  Isosphaera pallida
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_1684
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isop_1684
   00640 Propanoate metabolism
    Isop_1684
   00660 C5-Branched dibasic acid metabolism
    Isop_1684
Enzymes [BR:ipa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Isop_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2456702..2457970)
Genome map
AA seq 422 aa AA seqDB search
MNIHEYQAKALLKAAGAAVPAGEPATSAEEAARIYDVLGGGLMVVKAQVHAGGRGKGVAV
KPSDPSNPVADLATAYEIACGRAAAPEGVRRGVKLVRSREEARQVAEGLLGATLVTYQTG
PSGSPVHTVLVTVGHDIDRELYLGMTVDRTLKCPVLIASTEGGVDIETVAAQTPEKIHRE
PIDVGLRLRDFQARKVARALGLTGAAAKNGQKFLAALVDLFLDKDVALAEINPLIVTKDH
QVLALDAKISFDDNALFRHPEIAAMRDVQEEDPAELRAAQAGLSYVSLDGDIACLVNGAG
LAMSTMDIIKYHGGAPANFLDVGGGASKEQVQEGFRILLASPRVKAVLVNIFGGIMRCDT
IAGALLAAYDELQFNLPLVVRLEGTNVKEGKALLEQSGRPIITADGLTDAAQKVVAAAKG
QT
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgagtatcaggccaaggcgttgctcaaggcggccggagcggcggtgccc
gcgggcgaaccggcgaccagcgccgaggaggccgcccggatttacgacgtgttgggcggc
gggttgatggtcgtcaaggctcaggttcacgctgggggtcggggtaagggtgtggcggtc
aagccgtcggacccatccaatccggtggctgatctggccaccgcttacgagatcgcctgc
gggcgggctgcggcacctgaaggggtcaggcgtggggtcaagctggtccgcagccgcgag
gaagcccgccaggtggccgaggggttgctgggggccactctggtcacctatcagactgga
cccagcggcagcccagttcacactgtgttggtgacagtcggccacgacattgaccgggaa
ctgtatctcgggatgaccgtggaccgcacccttaagtgtccggtgttgatcgcctcgacc
gagggcggggtagacatcgagaccgtcgcggctcaaaccccggagaagattcaccgcgag
ccgatcgacgtggggctgcgtctgcgtgacttccaggcccgcaaggtcgctcgcgccctg
ggactgactggcgcagcggccaagaacggtcagaaattcctggccgcgttggtcgatttg
tttctggacaaggatgtggcgctggctgaaatcaacccgctgatcgttaccaaggaccac
caagtgctggcgttggatgccaagatcagctttgacgataatgcgttatttcgtcatccc
gagattgccgcgatgcgggatgtgcaggaggaggatccagcggagttgcgagcagctcag
gcggggttgtcctatgtgagtttggacggcgacattgcctgtctggtcaacggggccggt
ttggcgatgtccacaatggacatcatcaagtatcacggcggcgctccggccaacttcttg
gacgttggcggtggggccagcaaggagcaggtgcaggagggcttccggattttgctggct
tcgccgcgggtcaaggcggtgctggtgaacatttttggcggcatcatgcgatgcgacaca
atcgcgggggcattgttggccgcctacgacgaattgcagttcaacctgccgttagtggtt
cgtctggaagggaccaacgtcaaggagggcaaggcactgttggaacaatcaggtcgtccg
atcatcaccgccgacggtttgaccgacgcggctcaaaaggtagtcgcagccgccaagggc
caaacctga

DBGET integrated database retrieval system