KEGG   Isosphaera pallida: Isop_1724Help
Entry
Isop_1724         CDS       T01407                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_1724
   01230 Biosynthesis of amino acids
    Isop_1724
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_1724
  Energy metabolism
   00680 Methane metabolism
    Isop_1724
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_1724
Enzymes [BR:ipa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Isop_1724
Exosome [BR:ipa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Isop_1724
  Exosomal proteins of melanoma cells
   Isop_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2512216..2512971)
Genome map
AA seq 251 aa AA seqDB search
MPTQTLVMLRHGESRWNLENRFTGWVDVDLSDKGLAEAKRAGEQLKAEGFAFDVAYTSVL
KRAIRTLWLAMDELDQLWVPVVRSWRLNERHYGALQGLNKAETAARHGEDQVKIWRRSYD
IPPPPLSPDDPGHPRHDRRYRDLTPDQLPACESLKDTLARVLPYWNEVIAPDIQAGKQVL
IVAHGNSLRALVKHLDGLSDQDVLELNIPTGIPLVYQLDENLKPQGSRYLGDAEAVKAAA
EAVARQGRAGG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgccgactcagacgctggtgatgctccgccacggtgaaagccgctggaatctggagaac
cgtttcacgggatgggtcgatgtcgatctgtccgacaagggactcgccgaggccaaacgc
gctggggagcagctgaaggccgaagggttcgccttcgacgtggcctacacctcggtcctc
aaacgggcgatccgtaccctctggctggcaatggacgaactcgaccaactctgggtgccc
gtggtgcgaagctggcggctcaacgaacggcactatggcgcgcttcaaggactgaacaag
gccgagaccgccgcgcgtcatggcgaagatcaagtgaagatctggcgacgcagctacgac
atcccgcctccccccctctcgccggacgatcccggccacccgcgtcacgaccggcgttac
cgcgacctaacgcccgaccagttgcccgcgtgtgaaagcctcaaggacaccctggcgcgg
gtcctgccctactggaacgaggtgatcgcacccgacatccaggccggcaagcaggtgtta
atcgttgcccacggcaacagccttcgagccttggtcaaacaccttgacggcctgtcggat
caagacgttcttgaactgaatattccgaccggcattcccctggtctatcaactcgacgag
aatctcaagccgcaaggttcgcgttacctgggggacgcggaggcggtcaaggcggccgcc
gaggcggtagcgcgtcaaggtcgggcgggcggttga

DBGET integrated database retrieval system