KEGG   Isosphaera pallida: Isop_1877Help
Entry
Isop_1877         CDS       T01407                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ipa  Isosphaera pallida
Pathway
ipa00230  Purine metabolism
ipa01100  Metabolic pathways
Module
ipa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Isop_1877
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Isop_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 MMR_HSR1 RsgA_GTPase AAA_33 ABC_tran AAA_29 AAA_18 AAA_22 AAA_28 AAA_23 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ADV62458
UniProt: E8R226
Position
complement(2733181..2733819)
Genome map
AA seq 212 aa AA seqDB search
MTTNPTPGHDSGQVQPPPRGRLVVISGPSGAGKSSLTRAALNHPALRERAELSISATTRP
PRPGELNGRDYWFLDPEEFQKRRDQGRFLETAEVFGNWYGTPVDWVDQRLAQGRIVLLEI
DVAGARQIRKARPDAILIFVHPPNLAILEQRLRGRGSESEEAIARRLAHAQKEIDQAHVY
DFEILNDLFEPTVERLVQIILNPVPDDNPTVF
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaacccgactcccggccatgattccggccaggtccaaccaccgcctcggggt
cgtttggtggtgatctcaggcccctcgggcgcgggtaagtccagcctgacccgcgcggct
ctcaatcatcctgcgttgcgcgagcgggccgaactctccatctcggccaccactcgcccg
ccgcgcccgggcgaactgaatggccgggactattggtttctcgaccccgaggagtttcaa
aaacgccgcgaccaaggccgattcctcgaaaccgccgaggtctttggcaactggtacggc
acgccggtcgattgggtcgatcaacgcttggctcaaggacgcattgtcctactggaaatc
gatgtggccggtgcccggcaaatccgcaaggcgcgccccgacgccatcctcatcttcgtc
cacccgcctaacctggccattttggaacaacgcctgcgtggacgcggcagcgaaagcgag
gaggccatcgctcgccgtttggctcatgcccaaaaggaaatcgaccaggcgcacgtctac
gacttcgaaatcctcaacgacctcttcgaacccaccgtggagcgactcgtccaaatcatc
ctcaaccccgttcccgacgacaatcccaccgtcttctaa

DBGET integrated database retrieval system