KEGG   Isosphaera pallida: Isop_1881Help
Entry
Isop_1881         CDS       T01407                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_1881
   01230 Biosynthesis of amino acids
    Isop_1881
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_1881
   00051 Fructose and mannose metabolism
    Isop_1881
   00562 Inositol phosphate metabolism
    Isop_1881
Enzymes [BR:ipa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Isop_1881
Exosome [BR:ipa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Isop_1881
  Exosomal proteins of bladder cancer cells
   Isop_1881
  Exosomal proteins of melanoma cells
   Isop_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2735910..2736698)
Genome map
AA seq 262 aa AA seqDB search
MVHPSRPSFIAGNWKMNPATLEEAVTLAQQVRDGVRLDSPARVAICPPSIYLERLDRVLE
NSPIGLGAQNLYPEPKGAYTGEVSAAMLNAIGCTHVILGHSERRTLLGETDAFINRKLHA
ALANQALLPIVCVGETLDQRDAGQTLEVVKGQLEGSLAGLEADQAPQVTLAYEPVWAIGT
GRTATPEQAQEVHAMIRDWLAQRFGAAIAARIVIQYGGSVKPDNARDLLAQPDIDGALVG
GASLVAEDFLKIVEAAEAVLAG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtccacccctcccgtccatccttcatcgccggcaattggaagatgaatccggcgacc
cttgaggaagccgtgaccctggcccaacaggtccgcgacggggtccggctggactcccca
gcacgggtggcaatctgtccgccgtcgatttatttggaacggctggatcgggtgttggaa
aactcgccaatcggtttgggagcgcagaacctctatccggaacccaagggggcttacacc
ggcgaggtttcggcggcgatgctcaacgccattggctgcacccacgtgattctgggtcac
agcgagcggcggaccctgctgggcgagaccgacgctttcatcaaccgcaagctgcacgcg
gcgcttgccaaccaggcgttgttgccgatcgtctgcgtaggcgagacgctcgaccagcgc
gacgccggccaaaccctggaggtggtcaaaggtcagctggaaggctctctggccggtctg
gaggcggaccaggctccgcaggtcaccctcgcctatgagccggtctgggccatcggtacc
ggtcgcaccgccacgcccgaacaagcccaggaggtccacgccatgatccgtgattggctg
gcccaacggttcggcgcggcgattgccgcccggatcgtcatccaatacggggggagcgtc
aaaccggacaacgcccgcgacctcctggcccaacccgacatcgacggagccctcgtggga
ggcgcgagtctagtcgccgaggatttcctcaagatcgtcgaggccgcggaagcagttttg
gccggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system