KEGG   Isosphaera pallida: Isop_1881Help
Entry
Isop_1881         CDS       T01407                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ipa  Isosphaera pallida
Pathway
ipa00010  Glycolysis / Gluconeogenesis
ipa00051  Fructose and mannose metabolism
ipa00562  Inositol phosphate metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01120  Microbial metabolism in diverse environments
ipa01130  Biosynthesis of antibiotics
ipa01200  Carbon metabolism
ipa01230  Biosynthesis of amino acids
Module
ipa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_1881
   00051 Fructose and mannose metabolism
    Isop_1881
   00562 Inositol phosphate metabolism
    Isop_1881
Enzymes [BR:ipa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Isop_1881
Exosome [BR:ipa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Isop_1881
  Exosomal proteins of bladder cancer cells
   Isop_1881
  Exosomal proteins of melanoma cells
   Isop_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADV62462
UniProt: E8R230
Position
complement(2735910..2736698)
Genome map
AA seq 262 aa AA seqDB search
MVHPSRPSFIAGNWKMNPATLEEAVTLAQQVRDGVRLDSPARVAICPPSIYLERLDRVLE
NSPIGLGAQNLYPEPKGAYTGEVSAAMLNAIGCTHVILGHSERRTLLGETDAFINRKLHA
ALANQALLPIVCVGETLDQRDAGQTLEVVKGQLEGSLAGLEADQAPQVTLAYEPVWAIGT
GRTATPEQAQEVHAMIRDWLAQRFGAAIAARIVIQYGGSVKPDNARDLLAQPDIDGALVG
GASLVAEDFLKIVEAAEAVLAG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtccacccctcccgtccatccttcatcgccggcaattggaagatgaatccggcgacc
cttgaggaagccgtgaccctggcccaacaggtccgcgacggggtccggctggactcccca
gcacgggtggcaatctgtccgccgtcgatttatttggaacggctggatcgggtgttggaa
aactcgccaatcggtttgggagcgcagaacctctatccggaacccaagggggcttacacc
ggcgaggtttcggcggcgatgctcaacgccattggctgcacccacgtgattctgggtcac
agcgagcggcggaccctgctgggcgagaccgacgctttcatcaaccgcaagctgcacgcg
gcgcttgccaaccaggcgttgttgccgatcgtctgcgtaggcgagacgctcgaccagcgc
gacgccggccaaaccctggaggtggtcaaaggtcagctggaaggctctctggccggtctg
gaggcggaccaggctccgcaggtcaccctcgcctatgagccggtctgggccatcggtacc
ggtcgcaccgccacgcccgaacaagcccaggaggtccacgccatgatccgtgattggctg
gcccaacggttcggcgcggcgattgccgcccggatcgtcatccaatacggggggagcgtc
aaaccggacaacgcccgcgacctcctggcccaacccgacatcgacggagccctcgtggga
ggcgcgagtctagtcgccgaggatttcctcaagatcgtcgaggccgcggaagcagttttg
gccggctga

DBGET integrated database retrieval system