KEGG   Isosphaera pallida: Isop_1955Help
Entry
Isop_1955         CDS       T01407                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ipa  Isosphaera pallida
Brite
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Isop_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2843270..2844412)
Genome map
AA seq 380 aa AA seqDB search
MSSSSSSLSDPTPPLRPSQVNDRGEPMVAGFRREELGCPFGGLTVVTGGAGFLGSHLVEL
LQARGETIRVVERPGAAVDHLPNQVEVIRADIRDPEAVGQALRGADTVFHLAANPNLWAR
DKREFEAVNHQGTRHVLDQARRVGAKRIIHVSTESILTRRRHHGRGRAYQMIDEATVVTE
SDAVGPYCLSKLRAELAAFEAHRQGAPVWIVNPTMPIGPGDRNLSPPTRLIRDFLSGRLP
AWMEWTLNVIDPRDAALGMIRAAERGEPGHRHLLAGWNLTMSQLMVMLTSLSGVAAPRLR
VPSGIALLFAAWEEWRADHLGGGPPQASLTGVRLARRPARFDPSLTHRILGLQPRPLENS
LRDAIAWLREAGDLASSSTE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcctcgtcgtcctccctcagcgatccaaccccgccgctgaggccatcgcaggtc
aacgaccgcggcgaaccaatggttgcgggcttccgacgcgaggagctgggctgccccttc
ggtggtctcaccgtggtcaccggcggcgcggggtttctgggcagtcatctggtcgagctt
ctccaggcgcggggcgagacgatccgagtggtggagcgccccggcgcggcggtcgatcac
cttcccaaccaggtggaggtgattcgggccgacatccgcgaccccgaagcggtaggccag
gccttgcggggagccgacaccgtctttcatctcgcggccaaccccaacctctgggcgcga
gacaagcgggaattcgaggcggtcaaccaccagggaacccggcacgtgctggatcaggcc
cgccgagtcggagccaagcggatcatccacgtcagcaccgaaagcatcttgacccggcgt
cgccatcatggtcgtggtcgagcctaccagatgatcgacgaggcgacggtggttacggag
tcggacgcggtcggcccttactgtctctccaaactgcgggccgaactggccgccttcgag
gcacaccgtcaaggcgctccagtctggatcgtcaatcccaccatgccgataggtccgggg
gaccgcaacctttctccgccgacgcgattgatccgcgatttcctttcgggacggttgccc
gcctggatggagtggacgctcaacgtgatcgatccccgggacgcggcgctcgggatgatc
cgggccgccgagcgcggcgaaccaggtcatcgtcatcttttggccggttggaacttgacg
atgagccaactgatggtcatgcttacgtcactctccggagtcgctgcgcctcgattgcgt
gtgccttcgggaatcgctttgctgtttgcggcttgggaggaatggcgtgccgaccatctg
ggcggcggccctccgcaagcctcgctgactggagtccgcttggcgcgtcgtccggcacgg
ttcgatccgtcgctcacccaccgcatcttgggcctccaaccgcgtcccctggaaaactcg
ctacgcgacgccatcgcttggctacgcgaagccggtgacttggcttcctcttcaacagaa
tga

DBGET integrated database retrieval system