KEGG   Isosphaera pallida: Isop_2476Help
Entry
Isop_2476         CDS       T01407                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ipa  Isosphaera pallida
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Isop_2476
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Isop_2476
Exosome [BR:ipa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Isop_2476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3579883..3581388)
Genome map
AA seq 501 aa AA seqDB search
MSFLLALDQGTTSSRAIVFDTEGMIQGMGQREFPQHYPHPGWVEHDPMDLWSSQAGVISE
ALAQARIGPDQLAAVGIANQRETTLIWERATGTPVGPAIVWQDRRTAELCERLRARGVEP
LFTQRTGLCLDPYFSGTKLAWMLEHHPDLRARAERGELAFGTVDSWLVWQLTQGQRHVTD
PSNASRTLLFNLRTGDWDDDLLGILNIPRPLLPDLVPSQGVIGEVSHPLGPVGRPIAAIL
GDQQAALAGQVCFYPGMSKCTYGTGCFVLMNLGDDPRPSRHRLLTTAAWCLGAERSLVYA
LEGAVFIGGAVVQWLRDGLGLIRSSAEVEALATSVPDSGGVYFVPAFVGLGVPDWDPHAS
GTLIGIGRGTNAAHLARAALESIAFQVAEALHAMRADIEGSGFDLGELRVDGGASVNRTL
MQFQADLLGVAVVRPAVTETTALGAALFAGLGAGLWRDETELEGVWRAAERFEPRLAPSQ
AQARLARWREAVERSKGWRHD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtttctgctggcgctggatcagggaacaacgagttcccgggcgattgtcttcgac
acggagggcatgatccaagggatgggtcagcgcgagtttccccagcactatccgcatccg
ggttgggtggaacacgacccgatggatctttggtcgagtcaggcgggggtgatttccgaa
gcgctggctcaagcccgaatcggtcccgaccaactcgcggcagtggggattgccaaccag
agagaaaccaccctgatctgggagcgcgccaccggaacgccggtcggtccggcaattgtc
tggcaggatcgccgcactgccgagctttgcgaacggctacgcgcccggggggtcgagccc
ctgttcactcaacgaaccggcttatgtctggatccctatttctcgggcaccaagctggcc
tggatgctggaacaccatcccgacctccgcgcccgggccgaacggggcgaactggccttc
ggcactgtcgattcctggctggtgtggcaattgacccagggccaacgccacgtcaccgac
ccctccaacgcctcccgcaccctgttgttcaacctgcgcaccggcgactgggacgacgat
ctgctcggcattttgaacattccccggccgcttctgcccgacctggttccatcccaggga
gtgatcggcgaggtgtcgcaccctctgggaccggtgggccgaccgatcgccgccattctg
ggcgatcaacaagcggcgctagcgggtcaagtttgcttttaccctggcatgtccaaatgt
acgtatggcacaggctgctttgtgctgatgaacctgggtgacgatccacgcccctctcgc
caccgcctcttgaccaccgccgcctggtgcctcggagcggaacgctcattggtttacgcg
ttggagggagccgtcttcatcggaggggccgtggttcaatggcttcgcgacggcttgggc
ttgattcgctcctccgccgaggtcgaggctctggccacctcggtgcccgatagcggcggg
gtgtatttcgtcccggccttcgtcggtttgggcgtgcccgactgggatccccacgcgtca
ggcaccctcattggcattggtcgcggcaccaacgccgcccaccttgcccgagccgcgctg
gagtcgattgccttccaggtcgccgaagcgctacacgcgatgcgggccgacatcgaaggc
tctggcttcgatcttggggaactccgggtcgatggcggtgcgtcggtcaaccggacctta
atgcagttccaagccgacctgttgggtgttgcggtggtgcggcccgccgtcaccgaaacc
accgccttgggcgcggccctgtttgcgggtctgggagcgggactttggcgcgacgaaacc
gaactcgaaggcgtctggcgcgccgccgaacgcttcgaaccccgtctggctccctcgcag
gctcaagcccgtctagcccgctggcgcgaggcggtcgaacgttccaaaggatggcgacac
gactga

DBGET integrated database retrieval system