KEGG   Isosphaera pallida: Isop_2486Help
Entry
Isop_2486         CDS       T01407                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ipa  Isosphaera pallida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isop_2486
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_2486
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Isop_2486
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Isop_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598130..3599611)
Genome map
AA seq 493 aa AA seqDB search
MTTVLVPSVDPAHRLDGAFQRCLNLSCGATFGIEEPRFSCPVCGDLLDVTYDWDRLPVPT
SLHEFEAAWSDRGNPLNFSGVWRFRRLLPFAPESAIVTIGEGQTLLQTADAVASYVGVEA
GRLKLQYEGMNPSGSFKDNGMTAAFTHARMVGARRVACASTGNTSAALAVYCSATPHGFK
AIIFIGSGKIAYGKLAQALDHGALTIQIVGDFDDAMARVRQVADRLGIYLMNSVNPFRLE
GQKTIMYRVLEASNWEPPDWIVVPGGNLGNSSAFGKAFAELKELGLLKRLPRLAVVNAAG
ASTLDHLYNQAGMRWCDGEPDLRLADGYYRSLDAEGVKADTIASAIEINRPVNLKKCLRA
LSVCDGVVTQVSDQEILDAKAQVGSGGLGCEPASAASVAGARRLRREGIIAPSDQVVCVL
TGHQLKDPNATVAYHSGDRDLFDHVLGKRGVLRAGFANRPVVVPNDLDDIIRSIALYSAD
AGPDSARREGEAD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggttttggtcccttcggtcgatccggcccatcggctggacggcgcgtttcag
cgctgcctcaacttgtcgtgcggcgcgaccttcgggattgaagaaccgcggttttcctgt
ccagtctgcggcgacttgctggatgtgacctacgactgggaccgtctgccggtacccacc
agcctgcacgagtttgaagcggcctggtcggatcgaggcaacccgctcaacttctcgggg
gtctggcggttccgccgtttgttgccgtttgcgcccgagtcggcgatcgtgaccatcggc
gaggggcaaaccttgctccaaaccgccgacgcggtggcctcctacgtcggggtcgaggca
ggtcgcctcaagctgcaatacgagggaatgaacccctcgggcagcttcaaggacaacggc
atgaccgccgctttcacccacgcccggatggtcggagcccggcgggtcgcctgcgcgagc
accggcaatacctccgcggccctagcggtctactgttcggccacgcctcacggcttcaag
gcgatcatcttcatcggctcgggcaaaatcgcctacggcaaacttgcccaggcactcgat
cacggcgcgttgaccatccagatcgtgggcgacttcgacgacgcaatggcccgagtccgc
caggtggccgaccgcttgggcatctacctcatgaactcggtgaatccatttcggctcgaa
ggtcagaaaacgatcatgtatcgggttttggaggcttcaaactgggagcctcccgactgg
atcgtggtgcccggcggcaacttgggcaactcctcggcgttcggcaaggcgttcgccgag
ctcaaggagctggggttgttgaagaggctgccccggttagcggtggtcaacgcggctggg
gcttcgacgcttgatcacctctacaaccaggcggggatgcgttggtgcgacggtgagccg
gacctcaggctcgccgacggctattatcggagtctggacgccgagggggtcaaggccgac
accatcgcgtcggccatcgagatcaatcgaccggtcaacttgaagaaatgcctgcgggcg
ctgagcgtctgcgacggggtggtcactcaggtcagcgatcaggagattttagacgccaaa
gcgcaggtggggtcgggcggtctgggctgcgaaccggccagcgcggccagcgtcgccgga
gctcgaaggctgcgtcgcgaagggatcatcgccccgtccgaccaagtggtgtgcgtgctg
accggccaccaactcaaagaccccaacgccaccgtcgcctatcactccggcgaccgcgac
ctgttcgatcatgtgttgggcaagcgcggcgtactgcgggcgggattcgccaatcgcccc
gtggtcgtccccaatgatctcgatgacattattcgttcgatcgcgttgtattcggctgac
gctggacctgactccgcgcggagggagggggaggctgactag

  All links  
No link information was found.   
DBGET integrated database retrieval system