KEGG   Isosphaera pallida: Isop_2486Help
Entry
Isop_2486         CDS       T01407                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ipa  Isosphaera pallida
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isop_2486
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_2486
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Isop_2486
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Isop_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3598130..3599611)
Genome map
AA seq 493 aa AA seqDB search
MTTVLVPSVDPAHRLDGAFQRCLNLSCGATFGIEEPRFSCPVCGDLLDVTYDWDRLPVPT
SLHEFEAAWSDRGNPLNFSGVWRFRRLLPFAPESAIVTIGEGQTLLQTADAVASYVGVEA
GRLKLQYEGMNPSGSFKDNGMTAAFTHARMVGARRVACASTGNTSAALAVYCSATPHGFK
AIIFIGSGKIAYGKLAQALDHGALTIQIVGDFDDAMARVRQVADRLGIYLMNSVNPFRLE
GQKTIMYRVLEASNWEPPDWIVVPGGNLGNSSAFGKAFAELKELGLLKRLPRLAVVNAAG
ASTLDHLYNQAGMRWCDGEPDLRLADGYYRSLDAEGVKADTIASAIEINRPVNLKKCLRA
LSVCDGVVTQVSDQEILDAKAQVGSGGLGCEPASAASVAGARRLRREGIIAPSDQVVCVL
TGHQLKDPNATVAYHSGDRDLFDHVLGKRGVLRAGFANRPVVVPNDLDDIIRSIALYSAD
AGPDSARREGEAD
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggttttggtcccttcggtcgatccggcccatcggctggacggcgcgtttcag
cgctgcctcaacttgtcgtgcggcgcgaccttcgggattgaagaaccgcggttttcctgt
ccagtctgcggcgacttgctggatgtgacctacgactgggaccgtctgccggtacccacc
agcctgcacgagtttgaagcggcctggtcggatcgaggcaacccgctcaacttctcgggg
gtctggcggttccgccgtttgttgccgtttgcgcccgagtcggcgatcgtgaccatcggc
gaggggcaaaccttgctccaaaccgccgacgcggtggcctcctacgtcggggtcgaggca
ggtcgcctcaagctgcaatacgagggaatgaacccctcgggcagcttcaaggacaacggc
atgaccgccgctttcacccacgcccggatggtcggagcccggcgggtcgcctgcgcgagc
accggcaatacctccgcggccctagcggtctactgttcggccacgcctcacggcttcaag
gcgatcatcttcatcggctcgggcaaaatcgcctacggcaaacttgcccaggcactcgat
cacggcgcgttgaccatccagatcgtgggcgacttcgacgacgcaatggcccgagtccgc
caggtggccgaccgcttgggcatctacctcatgaactcggtgaatccatttcggctcgaa
ggtcagaaaacgatcatgtatcgggttttggaggcttcaaactgggagcctcccgactgg
atcgtggtgcccggcggcaacttgggcaactcctcggcgttcggcaaggcgttcgccgag
ctcaaggagctggggttgttgaagaggctgccccggttagcggtggtcaacgcggctggg
gcttcgacgcttgatcacctctacaaccaggcggggatgcgttggtgcgacggtgagccg
gacctcaggctcgccgacggctattatcggagtctggacgccgagggggtcaaggccgac
accatcgcgtcggccatcgagatcaatcgaccggtcaacttgaagaaatgcctgcgggcg
ctgagcgtctgcgacggggtggtcactcaggtcagcgatcaggagattttagacgccaaa
gcgcaggtggggtcgggcggtctgggctgcgaaccggccagcgcggccagcgtcgccgga
gctcgaaggctgcgtcgcgaagggatcatcgccccgtccgaccaagtggtgtgcgtgctg
accggccaccaactcaaagaccccaacgccaccgtcgcctatcactccggcgaccgcgac
ctgttcgatcatgtgttgggcaagcgcggcgtactgcgggcgggattcgccaatcgcccc
gtggtcgtccccaatgatctcgatgacattattcgttcgatcgcgttgtattcggctgac
gctggacctgactccgcgcggagggagggggaggctgactag

DBGET integrated database retrieval system