KEGG   Isosphaera pallida: Isop_2796Help
Entry
Isop_2796         CDS       T01407                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ipa  Isosphaera pallida
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isop_2796
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_2796
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Isop_2796
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Isop_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4066765..4067628)
Genome map
AA seq 287 aa AA seqDB search
MSVSFSSAPTATTAHGRIAALFDRLRNRRPALMPFVTAGDPNLETTAALLRVLGDRGADL
IELGIPYSDPIADGPVIAASYTRALKSGTRLDRILNMVRVLRSEGVATPMVAMSSYSIIY
RREPERFLADAHAAGLDGLIAPDLPVEEAESLLNKARAVGLDLIQLVTPTTPHERAARIV
ASCSGFVYYVSVAGTTGERHELPPDLLENVARLRSLTTLPICVGFGIGRPDQIAAIGTSA
DGLIVGSALVRRLAEAHDRAAGMAPLVEEIGDFVATLAQALPRNPQS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctccttctcctccgcaccgaccgccacgaccgcccacgggcggatcgccgcc
ctattcgatcgccttcgaaatcgacggccggcactgatgccgtttgtgaccgcgggcgac
cccaacctcgagaccaccgccgcgttgctgcgtgtcctcggagatcgcggggccgacttg
atcgagttggggattccctattccgacccgatcgccgacggaccggtcattgccgccagt
tacacccgggcgctcaagtcgggcacccgcctcgacaggatcctcaacatggtccgcgtt
ctgcgtagcgaaggggtggcaaccccaatggtggcgatgagttcctattcgattatctac
cgacgcgaacccgaacggttcctggccgacgcccacgctgctggtttggatggcctcatc
gccccagatttaccagtcgaagaggcggagagcctgttgaacaaagcccgcgccgtcggt
ctggacctgatccaattggtaacccccacgaccccgcacgaacgggccgcgcgaatcgtc
gcttcctgctctggcttcgtttactacgtctcggtagccggcaccaccggcgaacgccac
gaattgccgcccgacctgctcgagaatgtcgcccggttgcggagtctcaccacactgcca
atctgcgtggggttcggcatcggccggcccgaccagatcgccgccatcggcacctccgcc
gatggtctgatcgtcggcagtgccttggtgcgtcgtctggctgaagcccacgaccgcgcc
gctggtatggctcctttggtcgaagagatcggtgacttcgtcgccacgctggctcaagcg
ctgccccgcaacccgcagagttga

DBGET integrated database retrieval system