KEGG   Isosphaera pallida: Isop_2796Help
Entry
Isop_2796         CDS       T01407                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ipa  Isosphaera pallida
Pathway
ipa00260  Glycine, serine and threonine metabolism
ipa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
ipa01130  Biosynthesis of antibiotics
ipa01230  Biosynthesis of amino acids
Module
ipa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Isop_2796
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Isop_2796
Enzymes [BR:ipa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Isop_2796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADV63362
UniProt: E8R111
Position
complement(4066765..4067628)
Genome map
AA seq 287 aa AA seqDB search
MSVSFSSAPTATTAHGRIAALFDRLRNRRPALMPFVTAGDPNLETTAALLRVLGDRGADL
IELGIPYSDPIADGPVIAASYTRALKSGTRLDRILNMVRVLRSEGVATPMVAMSSYSIIY
RREPERFLADAHAAGLDGLIAPDLPVEEAESLLNKARAVGLDLIQLVTPTTPHERAARIV
ASCSGFVYYVSVAGTTGERHELPPDLLENVARLRSLTTLPICVGFGIGRPDQIAAIGTSA
DGLIVGSALVRRLAEAHDRAAGMAPLVEEIGDFVATLAQALPRNPQS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctccttctcctccgcaccgaccgccacgaccgcccacgggcggatcgccgcc
ctattcgatcgccttcgaaatcgacggccggcactgatgccgtttgtgaccgcgggcgac
cccaacctcgagaccaccgccgcgttgctgcgtgtcctcggagatcgcggggccgacttg
atcgagttggggattccctattccgacccgatcgccgacggaccggtcattgccgccagt
tacacccgggcgctcaagtcgggcacccgcctcgacaggatcctcaacatggtccgcgtt
ctgcgtagcgaaggggtggcaaccccaatggtggcgatgagttcctattcgattatctac
cgacgcgaacccgaacggttcctggccgacgcccacgctgctggtttggatggcctcatc
gccccagatttaccagtcgaagaggcggagagcctgttgaacaaagcccgcgccgtcggt
ctggacctgatccaattggtaacccccacgaccccgcacgaacgggccgcgcgaatcgtc
gcttcctgctctggcttcgtttactacgtctcggtagccggcaccaccggcgaacgccac
gaattgccgcccgacctgctcgagaatgtcgcccggttgcggagtctcaccacactgcca
atctgcgtggggttcggcatcggccggcccgaccagatcgccgccatcggcacctccgcc
gatggtctgatcgtcggcagtgccttggtgcgtcgtctggctgaagcccacgaccgcgcc
gctggtatggctcctttggtcgaagagatcggtgacttcgtcgccacgctggctcaagcg
ctgccccgcaacccgcagagttga

DBGET integrated database retrieval system