KEGG   Isosphaera pallida: Isop_2902Help
Entry
Isop_2902         CDS       T01407                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ipa  Isosphaera pallida
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Isop_2902
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Isop_2902
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Isop_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4233680..4234252
Genome map
AA seq 190 aa AA seqDB search
MLKPLLMVAALALLTLPLGLAVAAEQPSLDPPSCVLDLKAESIDGDTIDLASYKGEVLLI
VNTASQCGYTPQYKGLEALYRTYKDQGFKVLAFPCNDFGAQEPGDNAQIKDFCTKRYSVT
FPVFSKIVVKGANKHPVYQVLTQNGGEIRWNFTKFLIDREGKVVKRFEPGVDPTDEELVK
AIESALAQGK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacctctgctgatggtggccgccctggcccttctgactcttccgcttggtctg
gcggtcgccgccgaacaacccagtcttgacccacccagctgcgtcctggacctcaaggcc
gagtcgatcgacggcgacacgatcgatctggcgtcctacaagggtgaggtgctgttgatc
gtcaacaccgccagccaatgcggatacactcctcagtataaaggacttgaagcgctctat
cgcacgtacaaggatcaaggtttcaaggtcctggcttttccctgcaacgattttggtgcc
caggaacccggcgacaacgcccagatcaaggatttctgcactaaacgctattccgtaacc
ttcccggtgttcagcaagattgttgtcaagggagccaataagcatccggtttaccaagtt
ctcacccaaaacggcggtgaaatccgctggaattttactaagttcctaatcgaccgcgaa
ggcaaggtcgtcaagcggttcgagccgggggttgaccccaccgacgaagagcttgtcaag
gcgattgagtcggcgttggctcagggcaagtga

DBGET integrated database retrieval system