KEGG   Isosphaera pallida: Isop_2935Help
Entry
Isop_2935         CDS       T01407                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
ipa  Isosphaera pallida
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_2935
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Isop_2935
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Isop_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4281267..4283348
Genome map
AA seq 693 aa AA seqDB search
MSASRQHHVGVGVHGRGLVIDAATATARWLPIPPEVARSFLGGVGLSCWALAHLARQANA
WDILARDPLDPCAPLIFAFSPLVGSPLTTSAKFAVAAVSPLTGRFCDALCSSGFALAGKK
TGADLLAIVGQHPHPAVLWIDGLDPSHDDPDALPAIRFEPAGDVWGLPAAVAERRLLERA
GPGWELAAIGPAGERLIPFATLSHDGRHAGRGGLGAVLGSKRLKAVAVRGRRRVAWADPA
RAVQLARDLSARSFGPATAKYRELGTLANLLVFNRFQALPTRNFESGSFEQVERLAFDAP
GFDLAPAKRVARRSCVACTIGCEHLVAAPDRRSASRLATYSNTNTRIDTNAHVNPDANSS
PAGVRLEYESLFALGPLCGLSDPEAVVEAARLCDQAGLDTITTGATLAFLAECAGNGWID
DRVDPQRPDSPRLRFGDPEGFLAALDQLTRFPALSRSSDSPSPRDACEPNLVDLLALGSR
RAAQRIARLHPEALRLAPHVKGLELPGYDPRALHALAVGLAVGTRGADHNRSSAYDADFS
GHIDRLGANDAIVDAVIQAEDRAAWIDSLILCKFLRKLFTDPIEETLPFLEALCGWSIPL
DQARLTARRIVESRRLVNRRLGWTPAEDTLPPRLFDPPALPQSPFLDFDSFHRMVRRYHQ
QRGLDATGELTPPTRALLGLEGFPTAEIPQPQA
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctctcgacagcatcatgttggcgtgggggttcatgggcggggtctggtgatc
gacgccgccaccgcaacggcgcgctggctgccaatcccgccggaggtcgcgcgcagtttt
ttgggaggcgtcggcctgtcttgctgggcgttggctcatctggcgcggcaggcgaacgcc
tgggacatcctggcgcgcgatccgctcgatccctgcgccccgttgattttcgccttcagc
ccgctggtgggcagtccgttgaccacttcggcgaagttcgcggtggctgctgtttcgcct
ttgaccgggcgattctgcgacgcgctgtgttccagcggcttcgccctggcgggcaagaaa
actggagccgacttgctggcgatcgtgggacaacacccccaccccgcggtcctctggatc
gacggtttggatccctcccacgacgatcccgacgcgctgccagcgatccgcttcgagccg
gctggggacgtttgggggttgcccgcggccgtggcggagcgtcgtttgctggagcgcgcc
ggtcccggctgggaactggccgcgatcggcccggcgggcgaacgtctgatcccctttgcc
accctcagccacgatgggcgtcacgccgggcgcggcggtctgggcgcggtgctgggctcc
aagcgtctcaaggcggtcgcggttcgcggtcggcgtcgggttgcctgggccgaccccgcc
cgcgccgtccagttggcccgcgacctgtcggcccgctcgttcgggccggccaccgccaag
taccgcgaactcggcaccttggccaacctgctggtcttcaaccgcttccaagcgttgccc
acccgcaacttcgagtccggctcgttcgaacaagtcgaacgcctggccttcgacgcccct
ggcttcgacctggcccccgccaagcgggtcgcccgacgctcctgcgtggcctgcaccatc
ggttgcgagcacctcgttgctgcccccgatcgtcgctctgcgtcccgccttgccacctat
tccaataccaacacccgtattgataccaatgctcatgtcaatcccgacgccaacagttcg
ccagccggggtgcggttggagtatgaatcgctcttcgcgctgggaccgctttgcggtctg
tccgaccccgaggcggtcgtcgaggcggcccgcttgtgcgaccaggccggtctcgacacc
atcaccaccggcgcgaccttggcatttctggccgaatgcgctggcaacggttggatcgac
gaccgagtcgatccccaacgccccgattctccccgactccgattcggtgatcccgaagga
tttctggccgccctcgaccaactgacccgcttccccgctctttcccgctcctccgactcc
ccatcgccccgcgacgcctgcgaacccaacctggtggacctgctggccctgggcagccgt
cgcgcggctcaacggatcgcccgactccaccctgaagccctccgtctggcccctcacgtc
aaaggtctggaattgcctggttacgacccccgcgccctgcacgctttggccgttggactg
gccgttgggacccgtggagccgaccacaaccgctcctccgcctacgacgccgacttctcc
ggtcacatcgaccgcttgggggccaacgacgcaatcgtcgacgccgtcatccaggccgaa
gatcgcgccgcttggatcgactcgctgattctctgcaaattcctccgcaaactcttcacc
gatcccatcgaagagaccctcccgtttctggaggcgctctgcggctggagtatccctttg
gaccaagcccgcctcaccgcgcgacgcatcgtcgaatcccgccgcctggtcaatcgtcgc
cttggctggacccccgccgaagacaccctgccgccacgtctcttcgacccccctgccctg
cctcagtcccccttcctggacttcgactcgttccatcgcatggttcgccggtatcatcag
caacgaggactcgacgccactggagaattgactccccccacccgcgctctgctgggtttg
gaaggattccccaccgctgagattcctcaacctcaggcatga

DBGET integrated database retrieval system