KEGG   Isosphaera pallida: Isop_2970Help
Entry
Isop_2970         CDS       T01407                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_2970
   01230 Biosynthesis of amino acids
    Isop_2970
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_2970
   00030 Pentose phosphate pathway
    Isop_2970
   00051 Fructose and mannose metabolism
    Isop_2970
   00052 Galactose metabolism
    Isop_2970
  Energy metabolism
   00680 Methane metabolism
    Isop_2970
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Isop_2970
Protein phosphatases and associated proteins [BR:ipa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Isop_2970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4331591..4332985
Genome map
AA seq 464 aa AA seqDB search
MGVRVEKPPLKTTASRRAGLNLLGTLPKMIEPTGRLVEIERLGPATFPTNWRVARRAGDW
SLVDPAVRVRVRADWPLPPDHEELWFERAGPRRWLRFDPTQTKAAIVTCGGLCPGLNNVI
RSVYLELTRNYGVPTVLGIRHGYLGLTAEGPPPEVLTMERVGPIHRMGGTILGSSRGQRD
TAEMAATLERLGITMLFCVGGDGTQRGALAIGREIRAHGKEIAVVGIPKTIDNDLMYTDR
TFGFDTAIQIAHQVIQVAHTEAKAGVRGIGLVKLMGRDSGFIAAMATLACQEVNVTLIPE
VPFRLEGEEGLLAVLERRLDQRGHAVVVVAEGAGQDLFEGGPEALGFDASGNRRYHDIGL
FLKERITDHFKAIGKPADLKYLDPSYIIRSTPAICTDSALCDQLGRDAVHAALAGMTNVV
VTRLNNLPALVPMEMTVSRKRVIDPQGPIWTSVLAATGQPPLLR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggggttagggtggaaaagccgcccttgaaaaccaccgcgtcccgccgcgcggggttg
aacctccttggaacacttccaaagatgatcgaaccgactggacggcttgttgagattgaa
cgtctaggtcccgccacgtttcccaccaactggagggtggcgcgccgagcaggcgattgg
tcgttggtcgatccggcggtccgtgtccgcgttcgggccgattggcccttgccccccgac
catgaggaactttggttcgagcgggccgggcctcggcgttggctccggttcgaccccacc
cagactaaggcggcgatcgtgacctgtggcggcctttgccccggtctgaacaacgtgatc
cgctcggtttatctggaactaacccgcaactacggcgtgcccaccgtgctgggcatccgt
cacggctatctcgggctgaccgccgaggggccaccgccggaagtgctgaccatggagcgg
gtcggtcccattcaccgcatgggcggcaccattttgggcagctcgcgcggacaacgcgac
accgccgaaatggccgccaccctagaacgtcttggtatcaccatgctcttttgcgtcgga
ggggacggcacccagcgcggggcgctggcgattggccgggagatccgcgcccacggcaag
gagatcgccgtggtcggcattcccaaaaccatcgacaacgatttgatgtacaccgatcgc
acctttggtttcgacaccgccattcagatcgcccatcaggtcatccaggtggcccatacc
gaagccaaggccggagtgcgtgggattggcctggtcaagctgatgggacgcgactccggc
ttcatcgcggcgatggccaccctcgcgtgtcaggaggtcaacgtcacgttgattcccgag
gtgccgttccgtctggaaggggaagagggtctgctggccgtcttggaacgccggttggat
caacgcgggcacgccgtggtggtggtcgccgagggggccggtcaggacctcttcgaaggg
ggccctgaagccctcgggttcgacgcctcgggcaaccgtcgctaccatgacatcggcctc
ttcctcaaggagaggatcaccgaccacttcaaagcgatcggcaaacctgccgacctgaag
tatcttgacccaagctatattatccgcagcacaccggcaatctgcaccgactcggcactg
tgcgaccaactgggacgcgacgcggttcacgccgcgttggcgggaatgaccaacgtggtg
gtcacccgtttgaacaatctcccggctctggtgccgatggaaatgacggtctcccgaaag
cgggttatcgaccctcaaggccccatctggacctcggtgctggccgccaccggacaaccc
cccctgttgagataa

DBGET integrated database retrieval system