KEGG   Isosphaera pallida: Isop_2970Help
Entry
Isop_2970         CDS       T01407                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:ipa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ipa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ipa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ipa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ipa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ipa00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ipa00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4331591..4332985
Genome map
AA seq 464 aa AA seqDB search
MGVRVEKPPLKTTASRRAGLNLLGTLPKMIEPTGRLVEIERLGPATFPTNWRVARRAGDW
SLVDPAVRVRVRADWPLPPDHEELWFERAGPRRWLRFDPTQTKAAIVTCGGLCPGLNNVI
RSVYLELTRNYGVPTVLGIRHGYLGLTAEGPPPEVLTMERVGPIHRMGGTILGSSRGQRD
TAEMAATLERLGITMLFCVGGDGTQRGALAIGREIRAHGKEIAVVGIPKTIDNDLMYTDR
TFGFDTAIQIAHQVIQVAHTEAKAGVRGIGLVKLMGRDSGFIAAMATLACQEVNVTLIPE
VPFRLEGEEGLLAVLERRLDQRGHAVVVVAEGAGQDLFEGGPEALGFDASGNRRYHDIGL
FLKERITDHFKAIGKPADLKYLDPSYIIRSTPAICTDSALCDQLGRDAVHAALAGMTNVV
VTRLNNLPALVPMEMTVSRKRVIDPQGPIWTSVLAATGQPPLLR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggggttagggtggaaaagccgcccttgaaaaccaccgcgtcccgccgcgcggggttg
aacctccttggaacacttccaaagatgatcgaaccgactggacggcttgttgagattgaa
cgtctaggtcccgccacgtttcccaccaactggagggtggcgcgccgagcaggcgattgg
tcgttggtcgatccggcggtccgtgtccgcgttcgggccgattggcccttgccccccgac
catgaggaactttggttcgagcgggccgggcctcggcgttggctccggttcgaccccacc
cagactaaggcggcgatcgtgacctgtggcggcctttgccccggtctgaacaacgtgatc
cgctcggtttatctggaactaacccgcaactacggcgtgcccaccgtgctgggcatccgt
cacggctatctcgggctgaccgccgaggggccaccgccggaagtgctgaccatggagcgg
gtcggtcccattcaccgcatgggcggcaccattttgggcagctcgcgcggacaacgcgac
accgccgaaatggccgccaccctagaacgtcttggtatcaccatgctcttttgcgtcgga
ggggacggcacccagcgcggggcgctggcgattggccgggagatccgcgcccacggcaag
gagatcgccgtggtcggcattcccaaaaccatcgacaacgatttgatgtacaccgatcgc
acctttggtttcgacaccgccattcagatcgcccatcaggtcatccaggtggcccatacc
gaagccaaggccggagtgcgtgggattggcctggtcaagctgatgggacgcgactccggc
ttcatcgcggcgatggccaccctcgcgtgtcaggaggtcaacgtcacgttgattcccgag
gtgccgttccgtctggaaggggaagagggtctgctggccgtcttggaacgccggttggat
caacgcgggcacgccgtggtggtggtcgccgagggggccggtcaggacctcttcgaaggg
ggccctgaagccctcgggttcgacgcctcgggcaaccgtcgctaccatgacatcggcctc
ttcctcaaggagaggatcaccgaccacttcaaagcgatcggcaaacctgccgacctgaag
tatcttgacccaagctatattatccgcagcacaccggcaatctgcaccgactcggcactg
tgcgaccaactgggacgcgacgcggttcacgccgcgttggcgggaatgaccaacgtggtg
gtcacccgtttgaacaatctcccggctctggtgccgatggaaatgacggtctcccgaaag
cgggttatcgaccctcaaggccccatctggacctcggtgctggccgccaccggacaaccc
cccctgttgagataa

DBGET integrated database retrieval system