KEGG   Isosphaera pallida: Isop_2979Help
Entry
Isop_2979         CDS       T01407                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ipa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ipa00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ipa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ipa00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ipa00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ipa00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4341623..4342663
Genome map
AA seq 346 aa AA seqDB search
MSRGQDLTIGIDVGGTKILAAVVDRHNRILGRAKIATPAAQGETALLAAIVGCLEEALRE
AHTNIEQVESIGVGCPGPLDTKAGVVLSSANLNVQHFPLGPELARVTGRPVLLENDVRMG
GYGELKLGAGRDYDDLLIVFVGTGIGGCLVLDGQVRSGATGNAGEIGHTPIKPGGAKCGC
GNRGCLEAYASRSAISRRIVKQIRRGQPSILRAKLAKLDQPARLKSKDIQAAFELNDPVV
REAVERSAHRLGLALGGMINVLAPQRVILGGGIVEALGESYIDLVRASARRQAIADPAAV
VEIVASQLGDDAGALGAALWSREHQHRHAPPASNFPVTEQPAFIEP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacgtggccaggatttgacgattgggatcgatgtgggcggcaccaaaatcctggcc
gcggtggtggaccgccacaatcgcatcctgggccgggccaaaatcgccacgcccgccgcc
caaggcgaaaccgctctgttggcagccatcgtcggatgcctcgaagaggcgctacgtgaa
gcccacaccaacatcgagcaggtcgaatccatcggggtcggttgccccggcccgctcgac
accaaggccggcgtggttctctccagcgccaacttaaacgtccaacactttcccctgggt
cccgaactcgcccgggtcacaggccgcccggtgttgctcgaaaacgatgtgaggatgggg
ggctacggcgaactcaagctgggggccgggcgggactacgacgacctgctgattgtcttc
gtcggtaccggcatcggcggctgtctggtcctagatggccaagtccgcagtggggccacc
ggcaacgccggcgaaatcggccataccccgatcaagcccggcggcgctaagtgcggctgc
ggcaaccgcggctgcttggaagcctacgccagtcgttcggccatctctcgccgcatcgtc
aaacaaattcgccgcggccaaccctccatccttcgcgccaaactcgccaagctcgaccaa
cccgcccggctcaaatccaaagacatccaagccgccttcgaactcaacgaccccgtcgtc
cgcgaggcagtcgaacgttccgcccatcgtctgggtctggcgctcgggggcatgatcaac
gtgctggccccgcaacgagtcattttgggaggagggatcgtcgaagcccttggcgagtcc
tatattgacctcgtgcgtgcctcagcgcgtcgtcaggcgatcgccgatccggccgctgtg
gtcgagatcgttgccagccaacttggcgacgacgccggagccttgggagccgccctgtgg
tcccgcgaacaccaacaccgacacgcccccccagcaagcaacttccccgtcactgaacaa
cctgccttcatcgaaccctaa

DBGET integrated database retrieval system