KEGG   Isosphaera pallida: Isop_2994Help
Entry
Isop_2994         CDS       T01407                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ipa  Isosphaera pallida
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Isop_2994
DNA repair and recombination proteins [BR:ipa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Isop_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4365030..4365641
Genome map
AA seq 203 aa AA seqDB search
MAGYVATVEKLIAELGRLPGVGAKTAERLAHHILKVPAEEALALAEAIRQAKQRVGYCPI
CHNLVESDHELCAICRDPRRDHGIICVVEQCRDLMALESAGTYQGVYHVLHGRLAPLQGI
SAEHLTLESLERRMRSGTVREVILATNPNLEGDGTALWISQHLGGLGVPITKLARGLASG
STLEFANKEMLVDALNGRQAFHP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggccggctacgtcgccaccgtggagaaactgatcgcggaattgggacggcttcccggc
gtcggcgcgaaaaccgccgaacgcctggcccatcacatcctcaaagttcctgcggaagaa
gccctggctctggccgaagcgattcgtcaggccaaacagcgggtcggctactgccccatt
tgccacaacctggtcgagagcgatcatgaactctgcgccatttgccgcgacccccgccgc
gaccacggcataatctgcgtggtcgagcaatgccgcgacctgatggcattggaaagcgcg
ggaacctatcagggcgtgtatcatgtcctgcatggtcggctcgcccccttgcaaggcatc
agcgccgaacatctcacgctggagtcgctggaacgtcgaatgcgttcgggcacggtgcgg
gaagtgattctggcgaccaaccccaacctcgaaggggatggcaccgcgctttggatttca
caacacctcgggggtttaggggtgcccatcaccaaactcgcccgcggcctggcctccggg
tccaccctggaattcgccaacaaggagatgctggtggacgccctcaacggccgtcaagcc
ttccatccctga

DBGET integrated database retrieval system