KEGG   Isosphaera pallida: Isop_3103Help
Entry
Isop_3103         CDS       T01407                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ipa  Isosphaera pallida
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ipa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4529185..4529787
Genome map
AA seq 200 aa AA seqDB search
MEEDGPPTAASTPSPVDLERIARAVREILIAVGENPDREGIRDTPQRVARMYAEVFQGLH
QNPRDHLKTAFTETYEDTILIRDIAFISFCEHHLLPFVGKTHVAYRPRGRVVGLSKVPRV
VDVLSRRPQLQERLTTDLADLLHCELDAQGVAVMVEATHSCMTIRGVSKPGSSCWTFAMR
GVYETDPALRAEVLAMVRGG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacggtccccccaccgcagcctcgaccccaagtccggtcgatctggaacga
atcgcccgcgccgtgcgcgaaattttgatcgcggtgggcgaaaaccccgaccgggaggga
attcgcgacacccctcaacgggtcgctcggatgtacgccgaagtcttccagggcctgcac
caaaaccctcgggatcacctcaaaaccgccttcaccgagacctacgaggacacgatcctg
attcgggatatcgccttcatcagtttctgcgagcatcatttgttgcccttcgtaggtaag
acgcatgtcgcctatcgaccccgcggacgggtggtgggcctctccaaggtgcctcgggtg
gtggatgtcctctcccgccgtccacagttgcaggaacgcctcactaccgacctggccgac
ctgctccattgcgagctcgacgcccaaggcgtcgcagtcatggtcgaggcgacccattcc
tgcatgacgatccgcggggtcagcaagccgggcagctcctgttggaccttcgccatgcgc
ggggtttacgagaccgaccccgccctccgcgccgaggtgctggcgatggttcgaggaggg
tga

DBGET integrated database retrieval system