KEGG   Isosphaera pallida: Isop_3208Help
Entry
Isop_3208         CDS       T01407                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ipa  Isosphaera pallida
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Isop_3208
   01230 Biosynthesis of amino acids
    Isop_3208
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isop_3208
   00030 Pentose phosphate pathway
    Isop_3208
   00051 Fructose and mannose metabolism
    Isop_3208
   00052 Galactose metabolism
    Isop_3208
  Energy metabolism
   00680 Methane metabolism
    Isop_3208
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Isop_3208
Enzymes [BR:ipa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Isop_3208
Protein phosphatases and associated proteins [BR:ipa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Isop_3208
Messenger RNA biogenesis [BR:ipa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Isop_3208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4679077..4680378)
Genome map
AA seq 433 aa AA seqDB search
MAARNVVVAQSGGPTCVINNTLRGIIEACFADPATFGAVYAGRFGIEGVLKEELIDLSAS
SAEEIALLRTTPAAGAVGTCRYKLKPNQEEDFERVVEVLKAHDVGYFFYIGGNDSQDTAY
KVSQRAREVGLDLVAVGVPKTIDNDLGDDQFTLIDHSPGYGSAARYFANYILQANEENAG
SRTADPVLVIQAMGRKIGFIPAAARLADPERRLPLQIYMAESKLTLEQLGQNVLNQLERD
GRCLVVVSEGFDVGEFGVTRDAFGHIQFSASQTTVAQVVVNYLNTLKFPVTGKARGQVPG
TDQRNAMAYASGVDLDEAYEVGRHAVHLARTEGTGYMATLLRRRDTRAYQVIYDKVPLDK
VAAFDRSFPERWLAPNRIDVTDEFLAYAEPLIGGDWVSVPQVKGRARFARITPALVTPKL
PAYVPQTHRLKPE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcaatgtggtggtggcccagtcgggcgggccgacctgtgtgattaacaac
accctgcggggcatcatcgaagcctgtttcgccgatcccgccacctttggcgcggtgtac
gccggacggtttggcatcgagggcgttcttaaggaagaactgatcgacctgtccgcctcc
tccgccgaggagatcgccctattgcggactacgccggccgccggtgccgtgggcacctgc
cgctacaagctcaagccgaaccaggaggaggatttcgagcgggtcgtggaggtgctcaaa
gcccatgacgtgggctattttttctacatcggcggcaacgactcgcaggacactgcctac
aaggtcagtcaacgcgctcgcgaggtcgggctggacctggtggccgtcggtgttcccaaa
acgatcgacaacgaccttggggacgatcagttcaccctgatcgaccactctcccggctac
ggctcggcggcccgttacttcgccaactacatcttgcaggctaatgaggaaaacgccggc
agccggaccgctgaccccgttctggtgattcaggcgatgggccgcaagatcggcttcatc
cccgcggccgctcgtctggccgaccccgaacgccgcctcccgctccaaatctacatggcc
gaatctaagctcaccctggagcaactcggccaaaacgtcctcaaccaactcgaacgcgac
ggccgttgcctggtcgtcgtcagcgaagggttcgacgtgggcgagttcggcgtgacccgc
gacgctttcggccacatccagttctccgctagtcaaaccaccgtcgctcaggttgtggtc
aactacctcaacaccctgaaattccccgtcaccggcaaagcgcggggacaggttcccggc
accgaccaacgcaacgccatggcctacgccagcggcgtcgatctcgacgaagcttacgag
gtcggtcgtcacgccgttcatcttgcccgcaccgaggggaccggctacatggcgaccctg
ctgcgccggcgagacactcgtgcctaccaagtgatctacgacaaggtgccgctcgacaag
gtggctgccttcgaccgctccttccccgagcgctggctggcccccaaccgcatcgacgtg
accgacgaattcctcgcctacgccgaaccgcttattggcggcgattgggtctcggtgccc
caagtcaagggccgcgcccgcttcgcccggatcacccccgcgttggtcacgcccaagctg
cccgcctacgtcccgcaaacccatcgcctcaagcccgaataa

DBGET integrated database retrieval system