KEGG   Isosphaera pallida: Isop_3214Help
Entry
Isop_3214         CDS       T01407                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ipa  Isosphaera pallida
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Isop_3214
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Isop_3214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4688547..4690211
Genome map
AA seq 554 aa AA seqDB search
MDGLPPPLTNSPSPPSSSAVHPALGDPLDPSASAIGRGLSVEGAEGVPPSVQRPCRVVVL
GGGLSGLTAAYRLSRSGVQGQPLLEVVLLEARERVGGAIWTDREDGFTFEGGADSFITDK
PDALDLCLELGLELIPTQDHHRRSFVVHRGRLEPVPEGFVLMAPKRLTPLLTSPILSWRG
KLRVLMEPFIPRRSGEDLQDESLASFVKRRLGREALERLVQPLVAGIYTADPNELSLKAT
LPRFLEMERSQGGLIRAARRQERAARAHAASRQRSDPAAPDPTGSGARYGMFVTPAQGMA
SLIDALARALPPGTLRLRAPVRRVVPVPPSSALVEGGEPSRPWRVELLDGPAIEADAVIL
AVEAHAAARLVDGFDSELARLLRSIPYASSAILNLSFRRDQIAHPLNGFGAVVAARENRD
LLAVSFTSIKFPHRAPEGYVLMRAFFGGATRPDLFEHDDETLRRLALRELSDLLGVRGEP
IHVKVARHARAMPQYILGHLDRVEAIEQRVESHPGLALASNALRGVGVPDCVRSATRAAH
AVAQRLGLTRSHRA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtggatggattgccccctcctttgaccaattctccttcccccccctcctccagcgcggtt
cacccagcacttggtgatcctctggatccctcggcgtccgccattgggcggggactttcc
gtcgaaggggccgagggagtcccgcccagcgttcagcgtccgtgtcgcgtggtggttcta
ggtggtggcctaagcgggttgacggcggcctatcggctcagtcgaagcggtgttcaaggt
cagccgctcctcgaggtagtattgctggaggcccgcgagcgggtcggcggcgccatctgg
accgaccgcgaggatggcttcaccttcgagggtggggccgactcgttcatcaccgacaag
cccgatgcgttagacctttgcctggaactggggctggagttgatccctacccaggatcac
catcgtcgttcattcgtagtgcatcgagggcgtttggaaccggtgcccgaaggctttgtg
cttatggcccccaagcggctaacccctctgttgacttcgccgattctttcgtggcgtggc
aagttgcgggtgttgatggagccgttcatcccccgacgctccggcgaggaccttcaagac
gagtcgctggcctcgttcgtgaagcggcgtttgggacgcgaagcgctggagcgtctggtg
caaccgctggtggcgggcatctacaccgccgaccccaacgaactcagtctcaaagccacc
ctgccccgtttcttggaaatggagcgttcccaggggggactgattcgggccgcgcgccgt
caagaacgggccgcccgcgcccacgccgcgtcgcgtcaacgttccgatcccgccgccccc
gatccaaccggctccggcgcgcgctatgggatgttcgtcacgcccgcacaggggatggcg
agcctgattgacgccctggcccgcgcccttccccctggcaccctgcggctgcgtgctccg
gttcggcgcgtcgtgccggttccacccagctcggcgttggtcgagggcggcgaacccagc
cgtccgtggcgggttgagttgctcgacggcccagccatcgaggccgacgcggtgatcctc
gcggtcgaggcccacgccgcggcccgcctggtcgatggcttcgactccgagttggcccgg
ctgctccggagtatcccctacgcctcgtcggccatcctcaacctgagcttccgccgtgat
cagatcgctcacccgctcaacggcttcggcgccgtagtggccgcccgcgaaaaccgcgac
ttgctagccgtctcgttcaccagcatcaagttcccccatcgtgctcccgagggctatgtg
ctgatgcgggccttcttcggaggggccacccgacccgacctcttcgaacacgacgacgaa
accttgcgccggttggccctacgcgaattgagcgacttgttgggcgttcggggcgagccg
atccacgtcaaagtcgcccgtcacgcccgcgccatgccccaatacatcctgggccacctc
gatcgagtcgaggcgatcgaacaacgggtcgagtcccaccccggactcgcgctggccagc
aatgctctgcgcggggtcggcgtgcccgactgcgtgcgctctgctacccgcgctgcgcac
gccgtggcccaacggcttggcctgacgcgctcgcaccgagcttga

DBGET integrated database retrieval system