KEGG   Isosphaera pallida: Isop_3536Help
Entry
Isop_3536         CDS       T01407                                 

Definition
(GenBank) magnesium protoporphyrin chelatase, putative
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ipa  Isosphaera pallida
Pathway
ipa00860  Porphyrin and chlorophyll metabolism
ipa01100  Metabolic pathways
ipa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Isop_3536
Enzymes [BR:ipa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Isop_3536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: ADV64093
UniProt: E8QXQ6
Position
complement(5172746..5174206)
Genome map
AA seq 486 aa AA seqDB search
MTTEMASRFADRPRTLGQLKASGYQSRPVKEEMRTNLIAKLRRGEPLFPGIVGYEETVFP
QIINGILSRHDLLFLGLRGQAKTRMLRRLVDLLDEAIPIVAGSEINDDPLRPLSAYARQL
IRDHGDDTPIEWIGRDRRYLEKLATPDVSIADLIGEIDMIKVAEGRYLSNENVIHYGLIP
RTNRGIFCVNELPDLAPRIQVGLFNVLEERDLQIRGFPIRLELDVCMVFSANPEDYTNRG
RIVTPLKDRIGTVVRTHYPLTRELGIRINDENAYLDRPEGLALVIPPFIKELIEETSRLA
RTSPHVNQQSGVSTRMSIANLENIVSNAERRALVHHENVILPRPSDTNHLAPGSRGKLEL
LMTEDDTQEDLLILRLRDEALKVVFDQHISVKSLKPIVEWFDAGGTLELGDMVPSQEGAA
RIAQVPPLAQMVENLLERLIPEAVGRPSDQGGDAARVAVAELLLDGLHVHNRLNRSPKNS
GQSYRS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggagatggcgtctcggtttgccgaccggccccgcaccctgggccaactcaaa
gccagcggctaccagtcccgccccgttaaggaggaaatgcgcaccaacctcatcgccaaa
ctccgccggggcgaaccgctgtttcccggcatcgtcggctacgaagagacggtgtttcct
cagattattaacggcatcctctcacgtcacgacctgttgttcctaggcctccgcggccag
gccaaaacccgcatgctgcggcggttagtcgatctgctggacgaggcgattcccatcgtc
gcggggtcggaaatcaacgacgacccattgcgtcccctttcggcctacgcccgccaactc
atccgcgaccacggcgacgacaccccaatcgaatggatcggccgggatcgccgctatctg
gagaagctggcgacccccgacgtgtcgatcgccgacctgatcggtgaaatcgacatgatc
aaagtcgctgaaggtcgctacctttcaaacgagaatgtcatccactatggattgatcccg
cggaccaatcggggtatcttctgcgtcaacgaattgcccgacctcgcgccccgcattcaa
gtggggctgttcaacgtgctggaggagcgggatctgcaaatccgagggtttccgatccgg
ttggagttggatgtctgcatggtgttctcggccaacccggaggattacaccaaccggggc
cggatcgtcacgccgctcaaggatcggatcgggacggtcgtacgcacccactaccccctg
acccgtgagttggggatccgcatcaacgacgagaacgcctatctcgaccggcccgagggg
ctggcgttggtcatcccccctttcatcaaggagttgatcgaggagacctcgcggctggcc
cgaacctcgccccatgtcaaccaacagtcgggcgtctcgacgcggatgtcgatcgccaac
ctggaaaatatcgtctccaacgccgaacgtcgcgctttagttcaccatgaaaacgtgatc
ctaccccgcccctccgacaccaaccacttggcccccggctcgcgcggcaaactcgaactc
ctcatgaccgaagatgacacccaagaagatctgttgatcctacgcctccgcgacgaagcg
ttgaaagtcgtgttcgaccagcatatttcagtcaaaagcctcaagccaatcgtcgagtgg
ttcgacgcgggcggaaccctagaactcggcgacatggtgccaagccaggagggagctgcg
cgaatcgctcaagtgcctccgttggcgcaaatggtcgagaatctgctggaacgtctgatc
cccgaggccgtcggccgtccgtccgaccaaggtggcgacgcggcgcgagtggccgtggcg
gaactcctgctggacgggctccatgtccacaatcgtctcaaccgctcccccaaaaacagt
ggccagtcctaccggagttga

DBGET integrated database retrieval system