KEGG   Isosphaera pallida: Isop_3558Help
Entry
Isop_3558         CDS       T01407                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ipa  Isosphaera pallida
Brite
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Isop_3558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5213902..5215179
Genome map
AA seq 425 aa AA seqDB search
MRIGWGWLWVGLGLGIGSSWVTAQETLGRPQPRPERTAEERAAWVAELRRLYARPREEWP
APMVDEGVAWKEFAALPSRPKPTPLEEEWIEWGKRLFFDPRLSRTGEMACASCHDPDLGW
ADGRTVSFGLGRRPLKRNAPGLVFAAHASALFWDGRADSLETQARMVLLNEEEMGCSETI
ARELLERPEYRGLNELPIPKPNAEPTKDRVASPACDTPALDRVSRALAAFERAIPVIRAP
LDRFIEGEVQALSDEALIGLDLFRREGRCLNCHYGPLLSDGQFHEVGLSYFGRELEDLGR
FHVTGDPADSGKFRTPSLRNVALTAPYMHNGLFQLDGVLKMYNAGMPTIPRRGDAAEDPR
FPVKSPLLKPLGLNRRDLADLKAFLVEGLTSPPRRVRPPRWDRPLDPPVGPAATSKESES
GEVKE
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcggatggggttggttgtgggtggggttggggttagggatcgggtcgagttgg
gtgacggctcaagagactctcgggcgtcctcaaccgcgtccggagcgcacggcggaggag
cgggcggcgtgggtggcggagttgcgtcggctttacgcgcggccgagggaggaatggccc
gcgccgatggttgatgagggggtggcgtggaaggagttcgccgcgttgccttcgcgtccc
aagccgacgccgctggaggaggagtggatcgaatgggggaagcggctgtttttcgatccc
cggttgtcccgcacgggggaaatggcgtgcgcgtcgtgccacgaccctgacctaggatgg
gccgacgggcggaccgtctcgttcgggttggggcgtcgtcctctcaaacgcaacgcgcct
gggctggtgttcgcggcacacgcctccgcgctgttttgggatggccgggccgactcgctg
gagactcaggctcgcatggtgttgctcaatgaggaagagatgggttgctctgagacgatc
gctcgagagttgctcgaacgtcccgagtatcgcggtttgaacgagttgccaatccccaaa
ccaaacgccgagccaaccaaggatcgggtggcgtcgcctgcttgcgacaccccagcgctg
gatcgggtcagccgggctctagctgccttcgagcgggcgattccagtcatccgcgcgccg
ctggatcggttcatcgagggggaggttcaggcgctttccgacgaggcgttgattggtttg
gatctgtttcgccgcgaagggcgttgtttgaattgccactacgggccgttgttgagcgac
ggccagtttcacgaggtggggttgagctactttggacgcgagttggaagacctcggacgg
tttcacgtcaccggcgacccggccgattcggggaagttccgcactccgagcctgcgtaac
gtcgccctgactgcgccttatatgcacaatggattgtttcaactcgacggcgtgttgaag
atgtacaacgctgggatgccgacgattccccggcggggcgacgcggccgaggatccgcgg
tttccggtcaaatcgccgttgctcaaaccgctgggtttgaaccgccgcgacctcgccgat
ctcaaggcgtttttggtcgaggggttgacctcgccgccccgacgggtccgaccaccccgg
tgggatcgtccactcgatccgccggttggccctgcggcgacctcaaaagagtcagagtcg
ggtgaagtgaaggaataa

DBGET integrated database retrieval system