KEGG   Isosphaera pallida: Isop_3560Help
Entry
Isop_3560         CDS       T01407                                 

Definition
glutamate-5-semialdehyde dehydrogenase (EC:1.2.1.41)
Orthology
K00147  
glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
ipa  Isosphaera pallida
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ipa01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ipa00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5216372..5217694)
Genome map
AA seq 440 aa AA seqDB search
MIPDPHAHASADAATSADALSPDELKTICDHMADAAQRAARKLMTASGAAKDAWLKASAR
GLIAQTEAILAANARDLDHAQNAGLSRAAIDRLRLDSNRIAEIAHALEEIAALPDPLGET
LASSIRPNGLEVRKVRVPLGVVFMIYESRPNVTADAAALCVKSGNAVILRGGSEAFHSNH
ALHRVLADALEPAGLPREAVQLVPVTDRAAVGHLLTRSDAIDLAIPRGGAGLIRRVVAEA
RMPVLKHYDGNCHVYIDQYADPDMAEAIILNAKVQRPGVCNAAETLLIHRAIAATMLPRI
AERLLAHGVELRGDPEACALVPAMTPATPEDWDTEYLDLTLAVAVVDSLDAAIEHINRHG
SKHTDAIVSRDLESVRRFAARVDTAAVMINASTRFNDGGQLGLGAEIGISTDKLHARGPC
GLRELTTTKWIVTGSGHIRA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattccggacccacacgctcacgcatccgctgacgccgcgacctccgccgacgccctg
tcgcccgacgaactcaagacgatctgcgaccacatggccgatgcggcccaacgcgccgcc
cgcaagctcatgaccgcctcaggggcggccaaggacgcttggctcaaggcgtcggcccgc
ggcctgatcgctcaaaccgaggcgatcctcgcggccaacgcccgcgatctggaccacgct
caaaacgccggactcagccgcgcggcgatcgaccgtctacgactcgactccaatcgaatt
gccgagatcgcccacgccctcgaagaaattgccgcgctgcccgaccccttgggtgaaacc
ctcgcctcctccatccgtcccaacggtttggaggtccgcaaggtccgcgttcctctcggg
gtggtgttcatgatctatgaaagccgtccaaacgtcaccgccgacgccgcagcgctttgc
gtcaaaagcggcaacgcagtgatcctgcgggggggctctgaagcgttccactccaaccac
gccctgcatcgggtcttggccgatgcgttggaaccggccggcctgccccgcgaggcggtc
caacttgtgccggtcaccgatcgcgctgccgtcggccacctgctgacccgctccgacgcc
atcgacctggcgattccccgaggcggcgcgggtctgatccgccgggtcgtggccgaggcc
cggatgccggtcctcaaacattacgacggcaattgccatgtttacatcgaccagtacgcc
gatcccgacatggccgaggcgatcatcctcaacgccaaggtccaacgtcccggtgtgtgc
aacgcggccgagaccttgctgatccatcgcgctatcgccgcgaccatgctaccccggatc
gccgaacgcctgctggcccacggcgtcgaactgcggggcgaccccgaagcctgcgcccta
gtaccggctatgaccccggccacccccgaagactgggataccgaatacctcgacctcacc
ctggcagtcgcagtggtcgattcgctcgacgcggcgattgagcacatcaaccgccacggc
tccaaacacaccgacgccatcgtgtcacgcgacttggagagcgtccgccgcttcgccgcc
cgggtcgataccgccgcggtcatgatcaacgccagcacccggttcaacgacggcggccaa
ctcggcctgggcgcggaaatcggcatctccaccgataaactccacgcccggggaccctgc
ggcctacgcgaactgaccacgaccaagtggatcgtcaccggatcgggtcacatccgcgct
taa

DBGET integrated database retrieval system