KEGG   Isosphaera pallida: Isop_3560Help
Entry
Isop_3560         CDS       T01407                                 

Definition
glutamate-5-semialdehyde dehydrogenase (EC:1.2.1.41)
Orthology
K00147  
glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
ipa  Isosphaera pallida
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ipa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Isop_3560
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Isop_3560
Enzymes [BR:ipa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     Isop_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5216372..5217694)
Genome map
AA seq 440 aa AA seqDB search
MIPDPHAHASADAATSADALSPDELKTICDHMADAAQRAARKLMTASGAAKDAWLKASAR
GLIAQTEAILAANARDLDHAQNAGLSRAAIDRLRLDSNRIAEIAHALEEIAALPDPLGET
LASSIRPNGLEVRKVRVPLGVVFMIYESRPNVTADAAALCVKSGNAVILRGGSEAFHSNH
ALHRVLADALEPAGLPREAVQLVPVTDRAAVGHLLTRSDAIDLAIPRGGAGLIRRVVAEA
RMPVLKHYDGNCHVYIDQYADPDMAEAIILNAKVQRPGVCNAAETLLIHRAIAATMLPRI
AERLLAHGVELRGDPEACALVPAMTPATPEDWDTEYLDLTLAVAVVDSLDAAIEHINRHG
SKHTDAIVSRDLESVRRFAARVDTAAVMINASTRFNDGGQLGLGAEIGISTDKLHARGPC
GLRELTTTKWIVTGSGHIRA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgattccggacccacacgctcacgcatccgctgacgccgcgacctccgccgacgccctg
tcgcccgacgaactcaagacgatctgcgaccacatggccgatgcggcccaacgcgccgcc
cgcaagctcatgaccgcctcaggggcggccaaggacgcttggctcaaggcgtcggcccgc
ggcctgatcgctcaaaccgaggcgatcctcgcggccaacgcccgcgatctggaccacgct
caaaacgccggactcagccgcgcggcgatcgaccgtctacgactcgactccaatcgaatt
gccgagatcgcccacgccctcgaagaaattgccgcgctgcccgaccccttgggtgaaacc
ctcgcctcctccatccgtcccaacggtttggaggtccgcaaggtccgcgttcctctcggg
gtggtgttcatgatctatgaaagccgtccaaacgtcaccgccgacgccgcagcgctttgc
gtcaaaagcggcaacgcagtgatcctgcgggggggctctgaagcgttccactccaaccac
gccctgcatcgggtcttggccgatgcgttggaaccggccggcctgccccgcgaggcggtc
caacttgtgccggtcaccgatcgcgctgccgtcggccacctgctgacccgctccgacgcc
atcgacctggcgattccccgaggcggcgcgggtctgatccgccgggtcgtggccgaggcc
cggatgccggtcctcaaacattacgacggcaattgccatgtttacatcgaccagtacgcc
gatcccgacatggccgaggcgatcatcctcaacgccaaggtccaacgtcccggtgtgtgc
aacgcggccgagaccttgctgatccatcgcgctatcgccgcgaccatgctaccccggatc
gccgaacgcctgctggcccacggcgtcgaactgcggggcgaccccgaagcctgcgcccta
gtaccggctatgaccccggccacccccgaagactgggataccgaatacctcgacctcacc
ctggcagtcgcagtggtcgattcgctcgacgcggcgattgagcacatcaaccgccacggc
tccaaacacaccgacgccatcgtgtcacgcgacttggagagcgtccgccgcttcgccgcc
cgggtcgataccgccgcggtcatgatcaacgccagcacccggttcaacgacggcggccaa
ctcggcctgggcgcggaaatcggcatctccaccgataaactccacgcccggggaccctgc
ggcctacgcgaactgaccacgaccaagtggatcgtcaccggatcgggtcacatccgcgct
taa

DBGET integrated database retrieval system