KEGG   Isosphaera pallida: Isop_3728Help
Entry
Isop_3728         CDS       T01407                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ipa  Isosphaera pallida
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ipa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5468862..5469824
Genome map
AA seq 320 aa AA seqDB search
MFNDHAEAVPSPRSADADAGGAGLGQPQVRRAPAKLNLFLEVTTRRDDGYHAIETLMVTL
DWYDLLTARDDPSGLVRLTCDDPGLPTDATNLVVRAAEAIRRDLGVTRGVAFHLSKAIPS
ESGLGGGSSDAASALLLLRTLWGLEDRLGPVRLAELAAGLGSDVPFFLTGGAAVCRGRGE
LVEPIACPRYWFVVVRPPFGIATTRVYHGLELPARPTPIGPVQEAFLSGDPEALGGLLFN
RLQPRAERLAPGLGRVRHALDELIPHDCVGALMSGSGSACFALARTRDHAYAAAARLLER
HPGIGRVQVVSCGPGDDTAT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttcaacgaccacgccgaagccgtcccctcgccacgatccgccgacgccgatgccggc
ggcgcgggtctgggccaaccccaggttcgtcgggccccggccaagttgaatctctttctg
gaagtgacgacgcgccgcgacgacgggtatcacgcgatcgagaccctgatggtgacgctc
gattggtacgacctcctgaccgccagggatgacccgtccggcctggttcgactgacctgc
gacgatcccggtctgcccaccgacgcgaccaacctcgtggttcgcgcggccgaggcgatt
cgccgcgacctgggggtgacccgtggcgtggcgttccatctgtccaaggcgattccgagc
gagtcggggctggggggaggttcctccgacgccgcgtctgccctgctgttgctgcgaacg
ctttgggggttggaggatcgtctgggtccggttcggttggccgagttggccgccggactg
ggcagcgacgtgccgttctttctcaccggcggcgcggccgtgtgccgcggccggggcgag
ttggtcgagccgatcgcttgtccgcgttactggttcgtcgtggttcggccccccttcgga
atcgcgaccacccgcgtgtaccacggcctggaattgcccgcgcgtcccacgccgattggt
ccggttcaggaggcgtttctcagcggagacccggaggccctgggaggtctcctgttcaac
cgcctgcaaccccgcgccgagcgcctggcccccggattgggccgggtccggcacgctttg
gacgagttgatcccccacgattgtgtcggggcgctgatgagcgggtcgggatcggcctgc
ttcgccctggcccgaacccgcgatcacgcctacgccgccgcggcccgccttctcgagcgt
catcccgggatcggtcgagtccaagtcgtgtcgtgcggccctggagacgacaccgccacg
taa

DBGET integrated database retrieval system