KEGG   Ilyobacter polytropus: Ilyop_0104Help
Entry
Ilyop_0104        CDS       T01337                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_0104
   00020 Citrate cycle (TCA cycle)
    Ilyop_0104
   00620 Pyruvate metabolism
    Ilyop_0104
   00640 Propanoate metabolism
    Ilyop_0104
   00650 Butanoate metabolism
    Ilyop_0104
  Energy metabolism
   00680 Methane metabolism
    Ilyop_0104
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ilyop_0104
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ilyop_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
106922..107506
Genome map
AA seq 194 aa AA seqDB search
MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPERMGAPITAYNRISGEK
IRVHSNIYEPDYVVVVDDTLLSAVDVTKGLKKEGAIIINTSIPQKEILSKLKKYDGNVFL
CDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEESFKHKFASKPEVIKGNMK
ALKVSMGEVKICEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttggtagaaataagatggcatgggagagggggccaaggcgccaagacagca
tcgctgcttttggcagatgcagcctttacaattgggaaatttgtacagggatttccagaa
tacggtcctgagaggatgggggcaccgataactgcatataacaggataagtggcgaaaaa
ataagagttcactcaaatatttatgagcctgattatgtagttgtagtagatgacactctt
ttaagcgcagttgacgttacaaaagggcttaaaaaagaaggggcaattataataaatacg
tcaatacctcagaaagagattttaagtaaactaaaaaaatatgatggaaatgtatttttg
tgtgatgcaagaaaaatctcagaggaatctctcggaaagaatttccctaacactcctatg
cttggagctgttgtaaaggtaagtggtattatgagtgaagaggagtttttgggatctatg
gaggaatcttttaagcataagtttgcctcaaaacctgaagttataaaaggaaatatgaaa
gcgttgaaagtttccatgggagaggtgaagatctgtgaaaaataa

DBGET integrated database retrieval system