KEGG   Ilyobacter polytropus: Ilyop_0107Help
Entry
Ilyop_0107        CDS       T01337                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ilyop_0107
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ilyop_0107
   00020 Citrate cycle (TCA cycle)
    Ilyop_0107
   00620 Pyruvate metabolism
    Ilyop_0107
   00640 Propanoate metabolism
    Ilyop_0107
   00650 Butanoate metabolism
    Ilyop_0107
  Energy metabolism
   00680 Methane metabolism
    Ilyop_0107
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ilyop_0107
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ilyop_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
109002..109940
Genome map
AA seq 312 aa AA seqDB search
MAYNLKEQMNKPERLSGGHRMCAGCGAPIAVRTMLRALKPEDKATIVSATSCLEVSTFLY
PYTAWKDSFIHTAFENAGATMSGVEGAYNALRRKGKLDETYKFIAFGGDGGTYDIGFQSL
SGAMERNHDMVYVCYDNGAYMNTGIQRSSATPKYADTTTTPVGTESSGKIQPRKDMAAIM
AAHNIPYAAQTTFMGNMKDMHEKAEKAIYTKGAAYLNVMAPCPRGWRYDESKLMEICKAA
VDTCYWPCFEVINGEWKLSYRPKEKLPIEEFLKSQGRFKHLFKPENKHLIEEMQKEVDRR
WNELLKKCGEEV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatataatttaaaagaacagatgaataaacctgaaagactttcaggggggcacaga
atgtgtgccgggtgcggagcgcctatagcagtaagaactatgcttagagcgttaaaacca
gaagataaggcgactattgttagtgcaacaagttgtttagaagtttcaacgtttctttat
ccgtatacagcatggaaggattcctttattcatacagcctttgaaaatgcaggagcaaca
atgagtggagtggaaggagcctataatgcccttagaaggaaggggaaattagatgaaacc
tataaatttattgcgtttggtggagatggtggaacttatgatataggattccagtcactt
tctggagcaatggaaagaaatcatgacatggtgtatgtgtgttatgacaacggtgcctat
atgaatacagggatacagaggtcgtctgctacacctaagtatgcagataccacaacaact
ccagtaggaacggaaagttccggtaaaattcagccaagaaaagatatggctgcaataatg
gctgctcacaatattccttatgctgctcagactacttttatggggaatatgaaagatatg
catgaaaaggcagaaaaagcaatctatacaaagggagcggcctatctgaatgtaatggca
ccatgtcctagaggatggaggtatgatgagtcaaaattaatggaaatctgcaaagcagcc
gtagatacatgctattggccttgttttgaggttatcaacggagaatggaaactttcatac
agacctaaggaaaagcttcccattgaagaatttttaaaatctcaaggaaggtttaaacat
ctttttaaacctgaaaataagcaccttatagaagagatgcaaaaagaggtggacagaaga
tggaatgaacttttaaaaaaatgtggagaagaagtatag

DBGET integrated database retrieval system