KEGG   Ilyobacter polytropus: Ilyop_0183Help
Entry
Ilyop_0183        CDS       T01337                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ipo  Ilyobacter polytropus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ipo00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
207998..208552
Genome map
AA seq 184 aa AA seqDB search
MKKGDLFVVSGPSGAGKSTVCKLVRRMLEINLAVSATTRAPRAGEVDGREYYFLTMEEFQ
NKIKNNEFLEYANVHGNYYGTLKSEVEERLNEGKNIILEIDVQGGIQAREEYPDVNLIFF
KTPTKEDLEDRLRGRGTEDEETVRIRLENSLKELEFEKYYDKTVINHSIEQACYDLIKII
KKEA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagggtgatttatttgtagtttcgggacccagtggggccgggaaatctactgtt
tgtaaattagtcagaaggatgcttgaaataaatcttgcagtttctgctacaactagagct
ccaagagctggagaagtagatggaagagaatactattttctcacaatggaagaatttcaa
aataagataaaaaacaacgaatttttggaatatgcaaatgtacacggcaactactatgga
accttaaaaagtgaggtagaggaaagacttaacgaagggaagaatataattctagagatt
gatgttcaggggggaatccaagctagagaagaatacccagatgtaaacttaattttcttt
aaaacacctacaaaagaagatcttgaagacaggcttaggggaagaggaacagaggatgaa
gaaacagtcagaattagacttgaaaactctctaaaagagctggaatttgaaaagtattat
gacaaaactgtaatcaaccacagcatagaacaggcatgttatgatcttataaaaataata
aaaaaagaagcataa

DBGET integrated database retrieval system