KEGG   Ilyobacter polytropus: Ilyop_0326Help
Entry
Ilyop_0326        CDS       T01337                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ipo  Ilyobacter polytropus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ilyop_0326
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ilyop_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
372423..373340
Genome map
AA seq 305 aa AA seqDB search
MGKILVVGSINMDLVTKVSKSPKTGETVLGKDFKQIPGGKGANQAVAMARLGSDVAMIGM
LGKDSFGDTLLSVIKKDGVDISGIGRCKDISTGIATIVVDDDANNSIIVVPGANFEIEKK
DIDANIKLYENSEIVVHQLETPLDIVEYSLKISKKLGKTTILNPAPAKSMSDEIIKNVDY
LIPNETELELLAGVPVKNKEDILKACRKIMAKGVKKLIVTLGSKGAIYVDEKGSKEFGVY
KVDAVDTTAAGDSFIGGLTAAISKGEPLEKAMEFAAKVGAITVTREGAQTSLPTLDEVIN
FEGVV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatactggtagttggaagtataaatatggaccttgtaacaaaagtctcgaaa
tcaccaaagacgggagaaacagtcttgggaaaagattttaaacagataccaggaggaaaa
ggtgccaatcaggctgttgccatggctagactaggatcagatgttgctatgataggaatg
cttgggaaggattcctttggagatactctgctctctgtcataaaaaaagacggcgtggat
atctcaggcataggaagatgcaaagacatatcaacagggatagctaccatagttgtagat
gacgatgcaaataactctataatagtagtcccaggtgcaaactttgaaatagaaaaaaaa
gacatagatgcaaatattaaactttatgagaattccgaaatagttgtacatcagctagaa
accccattggatattgtggaatactctctgaaaatcagtaaaaaactagggaaaacgacc
atacttaatccggcacctgcaaaatcaatgtcagatgaaataataaaaaatgtagactat
ctcatccccaatgagactgaattagagcttcttgcaggggttcctgtaaaaaacaaggag
gatattctcaaggcttgccgaaaaattatggcaaaaggagtaaaaaaattgatagttacc
ttgggatctaaaggagcgatctatgtagacgaaaaaggttccaaagaatttggggtatat
aaggtggatgcagtagatactactgctgcaggagattcatttataggagggcttacagca
gccatttctaagggagagcccttagaaaaagctatggaatttgccgcaaaggtaggggca
ataacagtgacgagagagggagctcagacttcactccctacattagatgaggttataaat
tttgaaggagtggtgtaa

DBGET integrated database retrieval system