KEGG   Ilyobacter polytropus: Ilyop_0406Help
Entry
Ilyop_0406        CDS       T01337                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ipo  Ilyobacter polytropus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ipo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
456993..457586
Genome map
AA seq 197 aa AA seqDB search
MATKSLERLIDEFNKLPGIGRKSATRLAFHVLEMDDMEVNIFAEAIKNVKSSVKKCVICG
NFGEEETCDVCRDEYRTNEIICVVEDTRDIVSFEKAKKYRGRYHVLNGKIDPLNGMTPDK
LNIKSLVERVAAEDVKEVILAMNPDLEGETTAMYLTNLLKPFGIKVTKIASGIPMGGNIE
FSDIATISKALEGRREL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctactaaatcccttgaaagattgatagatgaatttaataaactccctggaatagga
agaaaaagtgcaactaggctcgcttttcatgtattagagatggatgatatggaggtaaat
atttttgcagaggcgataaaaaatgtaaagtcctctgtgaaaaaatgtgtgatctgtgga
aattttggagaagaggaaacatgtgatgtgtgccgagatgagtataggaccaatgagata
atctgtgtggtagaggacaccagagatatagtttcctttgagaaggcgaaaaagtatagg
ggaagatatcatgtcttaaacggaaaaatagaccctctaaacggtatgactccagataag
ctcaatataaaatctctagtagagagagtagcagctgaggatgtaaaggaggtcatactt
gccatgaacccagatctcgagggggagactacggcaatgtatctgaccaatcttttaaag
ccctttggaatcaaggtcactaaaatagccagtgggatccctatgggtggaaatatagag
ttttcagatatagccacaatatcaaaggcactagagggaagaagagaactttaa

DBGET integrated database retrieval system