KEGG   Ilyobacter polytropus: Ilyop_0482Help
Entry
Ilyop_0482        CDS       T01337                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ipo  Ilyobacter polytropus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ilyop_0482
   00670 One carbon pool by folate
    Ilyop_0482
Enzymes [BR:ipo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Ilyop_0482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
545109..545585
Genome map
AA seq 158 aa AA seqDB search
MISLIVAFDENRVIGKNNKLPWNIPEDMEKFKKATMGNIIIMGRNTFEGIGRPLPGRINI
VITKDESFHYKGVEVFHSVEEALEEALKLGKEVFFIGGESIYRQVADLVDKFYISYIHGK
YDGDSYFPEISLSNFQIIKEEIYDDFIYKEYEKNTLAL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgataagtttaatagtggcctttgatgaaaacagggttataggtaaaaataacaaatta
ccttggaatatacctgaagatatggaaaagtttaaaaaagcaaccatgggaaatattata
attatgggaagaaatacctttgaggggataggaagaccccttccaggaagaataaatatt
gtgatcacaaaagatgaaagttttcattataaaggggtagaagttttccacagcgttgaa
gaagccctagaagaagctttaaaacttggaaaagaggtatttttcataggtggagagagt
atatatcgtcaggtggcagatcttgtagacaagttttatatttcatatattcacggaaag
tatgatggagattcatattttccagaaataagtttgagcaattttcaaattattaaagaa
gagatttatgatgattttatttacaaagaatatgagaaaaataccctggctctttag

DBGET integrated database retrieval system