KEGG   Ilyobacter polytropus: Ilyop_0656Help
Entry
Ilyop_0656        CDS       T01337                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ipo  Ilyobacter polytropus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ilyop_0656
   00052 Galactose metabolism
    Ilyop_0656
   00500 Starch and sucrose metabolism
    Ilyop_0656
   00520 Amino sugar and nucleotide sugar metabolism
    Ilyop_0656
Enzymes [BR:ipo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ilyop_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
742909..743790
Genome map
AA seq 293 aa AA seqDB search
MTKVTKAVIPAAGLGTRLLPATKAQPKEMLTIVDKPSLQYIVEELVESGIKDIIIVTGRN
KDCIEDHFDYSYELEDTLLKQEKHALLAKVAELSSMVNIFYVRQTHPLGLGHAVLKAKPF
IGDEPFVIALGDDIMYNPDKPVSKQMMEKYEKYGSSIIGVQEVAKKNVSKYGIVDPGKKL
DDKTVEVEDFVEKPFVEDAPSRFACLGRYLLDGKIFDHLEGAKPGKGGEIQLTDAILKLR
KSGEKVAAYNFDGKRYDIGDKLGLLKANIEYGLKHDETKEGLLEYLKNDLKLV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaacaaaggcagtaattcctgcggcaggtttagggacaagacttcttccg
gctacaaaagcacagcctaaggagatgcttacaatagtagataaaccatctcttcagtat
atcgtagaggaacttgtagagtctggtataaaggatataataatagttacaggacgtaac
aaagattgtatagaggatcattttgattattcttatgagctagaggatactcttttaaag
caggaaaaacatgctctgctggctaaagttgcagagctttccagtatggttaatattttt
tatgtgagacagactcaccctttaggactagggcatgcagttctgaaagctaagccattt
ataggagatgaaccttttgtaatagccttaggagacgatataatgtataaccctgataaa
cctgtaagcaaacagatgatggaaaaatatgaaaagtatggaagtagtattataggggtt
caagaagttgcgaagaagaatgtttctaagtatggtatagtagatcctgggaaaaaatta
gacgacaagactgttgaagtagaagattttgtggaaaaaccatttgtagaagatgctcca
tcgaggtttgcttgtctaggaagatatctcttagatggtaaaatctttgatcatttagaa
ggtgcaaaacctggaaaaggcggagagatacagctgacagatgcaattctcaagcttagg
aaatccggtgaaaaagtggcggcctataactttgacggaaagcgttatgatataggggat
aaattgggtcttttaaaagccaatattgaatatgggctgaaacatgacgaaacaaaagaa
gggctattagaatacttaaaaaatgatttgaaactagtttaa

DBGET integrated database retrieval system