KEGG   Ilyobacter polytropus: Ilyop_0669Help
Entry
Ilyop_0669        CDS       T01337                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ipo  Ilyobacter polytropus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_0669
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ilyop_0669
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ilyop_0669
Enzymes [BR:ipo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ilyop_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762811..764280
Genome map
AA seq 489 aa AA seqDB search
MRYVSTRGNLEKSYSAAEAIREGMVPGGGLFVPESFPKFTLDEINSLKKLNYQEVSIEVL
KKYLSDYTEEEIKECVEGAYSDINFSHKERTPVVKVEDEVYVMELWHGPTAAFKDMALQL
MPRLFVKAREKTNAVDDTLILVATSGDTGKAALEGFKNLKGIKVVVFYPEEGVSQVQKLQ
MITTEGDNLTVSALKGNFDDCQTGVKDIFSDEEFNSILKGLELSSANSINLGRLLPQVIY
YFKAYAQMLRDNEITLGEKVDFCVPTGNFGNILAGYYAMEMGLPVGKLICASNKNNVLTD
FLQSGTYDKKRDFHKTMSPSMDILVSSNLERFLYHTLGDADKVSKIYERFNRDGVFSIEK
QELENIQNIMESGYTDEDMCIDTIKNVFENDNYIMDTHTSVAMNVALRKKTERKVVVLST
ASIYKFPSSVLRSFGKQGETEFKEIEMLNEITGVELHSAVKGIDKLPVLHKNCIEKDGMK
EFLENLIKK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgttagtactaggggaaaccttgaaaaaagttattcggcagcagaagccata
agagagggaatggttccaggaggaggactttttgtacctgagagttttcctaaatttact
cttgacgaaataaacagcttgaaaaaacttaactaccaagaagtttctattgaagtactg
aaaaaatatctttctgactatacagaagaagagataaaagaatgtgtagagggtgcttac
agcgacattaatttctcacacaaagaaagaactcctgtggtgaaagtcgaggatgaagta
tatgtaatggaactatggcatggtccaacagctgcatttaaggatatggcacttcagctt
atgccaagactctttgtgaaagctagagagaaaacaaatgctgtagacgatacccttata
cttgttgctacttctggtgatactggaaaggcagctcttgaaggatttaaaaatcttaag
gggattaaagtagttgttttttatccagaagagggtgtaagccaggttcaaaaacttcaa
atgataacaacagagggagataatctaactgtttctgcattaaaagggaactttgatgac
tgccagacaggtgtaaaggatattttttcagacgaagagtttaatagtattttgaaaggc
ctagagctgtcttcggcaaattccataaatctaggcagacttcttcctcaagtaatatac
tattttaaggcctatgcacagatgctgagagacaatgaaattaccctaggggaaaaagtg
gacttctgtgttccaacaggaaactttggaaatatactagcaggttattatgctatggaa
atgggtcttccagttggaaaactgatctgtgcttctaataaaaacaatgttttgacagac
tttcttcagagcggaacctatgacaaaaaaagagattttcataaaacaatgagtccatct
atggatattttagtttcttcaaatcttgaaagatttctttatcatacactgggagatgct
gacaaagtttctaagatctacgaaaggttcaatagagacggagttttcagtatagaaaag
caggagctagaaaatattcagaatattatggaatctggatacactgatgaagatatgtgt
atagatacaataaaaaatgtttttgaaaatgataactatataatggacactcatacttcg
gtagctatgaatgtagcacttagaaaaaaaactgaaagaaaagtagtagtattatccaca
gccagtatatataaatttccttcaagtgtcttaaggtcatttgggaaacagggagaaact
gagtttaaagaaatagagatgttaaatgaaataacaggtgtagaacttcacagtgcagta
aaagggatagataaacttcctgtactccataaaaactgcatagaaaaagatggaatgaaa
gaatttttggaaaatctaataaaaaaataa

DBGET integrated database retrieval system