KEGG   Ilyobacter polytropus: Ilyop_0760Help
Entry
Ilyop_0760        CDS       T01337                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ipo  Ilyobacter polytropus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ipo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ilyop_0760
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ilyop_0760
Enzymes [BR:ipo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ilyop_0760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(864356..865741)
Genome map
AA seq 461 aa AA seqDB search
MNLQEKAISYKEDVIKSIQEAVRIKSVEEAPLPGKPFGKGPAEALKYFLQLGESMGFEVK
NFDNYAGHIDFGSGEETIGILGHVDVVPEGEGWSHPPYAGEIGDGKIFGRGVLDDKGPMI
TCLYAMKAIKDSGLKTDKKIRMILGANEESGWGCMDHYFGKLNMPHPELSFTPDSTFPVT
FAEKGIMQVVLKKNYEDSENIKIKGGNAFNSVSEKAFLEISEDSGKIILDYIDSFNKDKD
YKLEVEKKSGNIIFTSNGKSAHASRPDKGYNAISALMKCISESGYKGGPLEEIAKFFSEK
IKMETNGASMDVNFEDKDSGELTLNIGMISLEKNSLEISFDIRYPVTIEKDSVLDGLEKN
ASEFGMEMEVVGGKDPLYIPRDHFLVKTLMDVYKDVTGDLEAEPIAIGGGTYARAIKNCV
AFGSLLHDQEDNMHQKDEYLEISKIDTWLKIYTEAIYKLAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacaggaaaaagctataagttacaaagaagatgtaataaaatcaatacaagaa
gctgttagaataaaaagtgtagaggaggctccgcttcctggtaaacctttcggaaaggga
cctgcagaggcacttaaatattttcttcagttgggagaaagtatgggctttgaagtaaaa
aactttgataattatgcaggtcatatagactttggttctggtgaagagacaataggtata
ttaggccatgtagatgtggttccagaaggtgaaggatggagccatcctccctatgcagga
gaaatcggagatggcaaaatattcggacgtggagttcttgatgacaagggtcctatgata
acatgcctttatgcaatgaaagccataaaagattctggacttaaaacagataaaaaaata
agaatgattctaggtgccaatgaagaatcaggttggggatgcatggatcattattttgga
aaacttaatatgcctcatccagaactttcttttacacctgactctactttccctgttacc
tttgctgagaagggaattatgcaggtagttttaaagaaaaactatgaagattcagagaac
atcaaaataaaaggtggaaatgcctttaattctgtttctgaaaaagcatttttagagatt
tcagaggactctggaaaaataattttagattatattgattctttcaataaagataaagat
tataaactagaagtggaaaaaaaatcaggaaatattatttttacatcaaatggtaaatct
gcccatgcttctcgacctgataagggatataatgctatctccgcactgatgaaatgcatc
tctgaatcaggatataaaggtggacctttagaagagatagcaaaatttttctctgaaaag
ataaagatggagactaacggcgcatctatggatgtaaactttgaagataaagattctggc
gaacttaccctcaacataggtatgatctctctagaaaaaaacagcctggaaatctcattt
gatataagatatcctgtgactatagaaaaagattcagtgctcgatgggctagaaaaaaat
gcttcagaatttgggatggaaatggaagtagttggaggtaaggaccctctatacattcct
agagatcacttccttgtaaaaacacttatggatgtctataaggatgtgactggtgactta
gaagccgagcctatcgctatagggggaggtacctacgccagagctattaaaaactgcgta
gcatttggttctctcttacacgatcaagaggacaatatgcatcaaaaagatgaatatctt
gagataagtaaaatagatacttggctcaaaatatacactgaagccatatataaacttgca
aaataa

DBGET integrated database retrieval system