KEGG   Ilyobacter polytropus: Ilyop_0760Help
Entry
Ilyop_0760        CDS       T01337                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ipo  Ilyobacter polytropus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ipo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ipo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(864356..865741)
Genome map
AA seq 461 aa AA seqDB search
MNLQEKAISYKEDVIKSIQEAVRIKSVEEAPLPGKPFGKGPAEALKYFLQLGESMGFEVK
NFDNYAGHIDFGSGEETIGILGHVDVVPEGEGWSHPPYAGEIGDGKIFGRGVLDDKGPMI
TCLYAMKAIKDSGLKTDKKIRMILGANEESGWGCMDHYFGKLNMPHPELSFTPDSTFPVT
FAEKGIMQVVLKKNYEDSENIKIKGGNAFNSVSEKAFLEISEDSGKIILDYIDSFNKDKD
YKLEVEKKSGNIIFTSNGKSAHASRPDKGYNAISALMKCISESGYKGGPLEEIAKFFSEK
IKMETNGASMDVNFEDKDSGELTLNIGMISLEKNSLEISFDIRYPVTIEKDSVLDGLEKN
ASEFGMEMEVVGGKDPLYIPRDHFLVKTLMDVYKDVTGDLEAEPIAIGGGTYARAIKNCV
AFGSLLHDQEDNMHQKDEYLEISKIDTWLKIYTEAIYKLAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacaggaaaaagctataagttacaaagaagatgtaataaaatcaatacaagaa
gctgttagaataaaaagtgtagaggaggctccgcttcctggtaaacctttcggaaaggga
cctgcagaggcacttaaatattttcttcagttgggagaaagtatgggctttgaagtaaaa
aactttgataattatgcaggtcatatagactttggttctggtgaagagacaataggtata
ttaggccatgtagatgtggttccagaaggtgaaggatggagccatcctccctatgcagga
gaaatcggagatggcaaaatattcggacgtggagttcttgatgacaagggtcctatgata
acatgcctttatgcaatgaaagccataaaagattctggacttaaaacagataaaaaaata
agaatgattctaggtgccaatgaagaatcaggttggggatgcatggatcattattttgga
aaacttaatatgcctcatccagaactttcttttacacctgactctactttccctgttacc
tttgctgagaagggaattatgcaggtagttttaaagaaaaactatgaagattcagagaac
atcaaaataaaaggtggaaatgcctttaattctgtttctgaaaaagcatttttagagatt
tcagaggactctggaaaaataattttagattatattgattctttcaataaagataaagat
tataaactagaagtggaaaaaaaatcaggaaatattatttttacatcaaatggtaaatct
gcccatgcttctcgacctgataagggatataatgctatctccgcactgatgaaatgcatc
tctgaatcaggatataaaggtggacctttagaagagatagcaaaatttttctctgaaaag
ataaagatggagactaacggcgcatctatggatgtaaactttgaagataaagattctggc
gaacttaccctcaacataggtatgatctctctagaaaaaaacagcctggaaatctcattt
gatataagatatcctgtgactatagaaaaagattcagtgctcgatgggctagaaaaaaat
gcttcagaatttgggatggaaatggaagtagttggaggtaaggaccctctatacattcct
agagatcacttccttgtaaaaacacttatggatgtctataaggatgtgactggtgactta
gaagccgagcctatcgctatagggggaggtacctacgccagagctattaaaaactgcgta
gcatttggttctctcttacacgatcaagaggacaatatgcatcaaaaagatgaatatctt
gagataagtaaaatagatacttggctcaaaatatacactgaagccatatataaacttgca
aaataa

DBGET integrated database retrieval system